DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and sro

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster


Alignment Length:239 Identity:60/239 - (25%)
Similarity:91/239 - (38%) Gaps:44/239 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GSALSAIGIYLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKK 79
            ||.|    :..||:.:..|:...|. ::..|.::|||:.|:|....:..........::|     
  Fly     3 GSQL----LRALRRSLGLGRQQLKV-DSRHVVLITGCDSGLGHSMAVYCHESLHMTVISC----- 57

  Fly    80 CENARREIIKATNN--------QNIFARQLDLCSMKSI-------RNFAAGFKREQNKLHILINN 129
            |.|.:.|..|....        ..:...:|||....||       |:..|  |....:|..||||
  Fly    58 CHNIKSEGAKLLQGLASAKDGLSRMHTLELDLLEPDSIRLVHRQLRDILA--KDPSYRLTALINN 120

  Fly   130 AGIM---DCPKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDD 191
            ||:|   :....|||. .|.||..|.:|...||..||.:|:.. ..|::.::|..          
  Fly   121 AGVMCFGEFEWQLTEQ-IEAQINCNLLGTMRLTHELLPLLRQQ-QGRIINVTSHC---------- 173

  Fly   192 LNSEKSYDRKMAYCQSKLANVLFTRELAKRLSGTGVTVNALHPG 235
              ..::......|..||.|...:|..|...|...|:.|....||
  Fly   174 --GLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVNFIPG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 53/213 (25%)
NADB_Rossmann 43..317 CDD:304358 53/211 (25%)
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 53/210 (25%)
adh_short 28..229 CDD:278532 53/209 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.