DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and CG8888

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:230 Identity:51/230 - (22%)
Similarity:91/230 - (39%) Gaps:37/230 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ALSAIGIYLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCE 81
            ||:.:|..|...::       |.:.:|:..::|||...:......:|...|.|||.......: |
  Fly    76 ALATVGAVLFYHFV-------KVSASGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIE-E 132

  Fly    82 NARREIIKATNNQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAG---IMDCPKMLTEDG 143
            :...:|:|...:..:....||:.|.|:|.. ||.:..:    |:.....|   ::.|...:....
  Fly   133 SDEAKILKEVTSGRMKLLHLDVTSEKTILE-AARYVSQ----HLPHGAEGLWSVVHCAHWIALGE 192

  Fly   144 FE--------MQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSEKSYDR 200
            .|        ..:.:|.:|...||.:.|.::: .|..|||.|:|           .||...|..|
  Fly   193 LEWIPFAVLRKSLDLNLLGSARLTQIFLPLVR-RAHGRVVFLTS-----------GLNRVPSPVR 245

  Fly   201 KMAYCQSKLANVLFTRELAKRLSGTGVTVNALHPG 235
            .: .|.::.|...|...|.:.:...||.|:.:..|
  Fly   246 GI-QCATQAAVDCFAACLRQEMRTRGVDVSVVAAG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 46/206 (22%)
NADB_Rossmann 43..317 CDD:304358 46/204 (23%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 45/203 (22%)
adh_short 96..293 CDD:278532 45/203 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.