DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and CG9265

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster


Alignment Length:219 Identity:54/219 - (24%)
Similarity:83/219 - (37%) Gaps:29/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSAIGIYLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCEN 82
            :..||..|...|.....:..|...|. :|::||...|:|:.....|.:.|..|.:  .|:.|  .
  Fly    62 ICCIGYILQDLYYIAFGYPEKELNTD-IALITGGGNGLGRLLAERLGKMGTKVVI--WDINK--K 121

  Fly    83 ARREIIKATNNQNIFAR--QLDLCSMKSIRNFAAGFKREQNKLHILINNAGI------MDCPKML 139
            ...|.::.......:.:  .:|:...:.:...|...:.|...:.:||||||:      :|.|..|
  Fly   122 GIAETVQIVEEAGGYCKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHL 186

  Fly   140 TEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSEKSYDRKMAY 204
            .|..|    .||.|.||..|...|..:..:....:..::|:|...|..|..|            |
  Fly   187 IERSF----NVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVD------------Y 235

  Fly   205 CQSKLANVLFTRELAKRLSGTGVT 228
            |.||.|.|.|...|...|...|.|
  Fly   236 CASKFAAVGFDEALRLELEVLGHT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 49/196 (25%)
NADB_Rossmann 43..317 CDD:304358 48/194 (25%)
CG9265NP_001260655.1 fabG 82..299 CDD:235546 50/199 (25%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 48/192 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447620
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.