DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and CG13284

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001260523.1 Gene:CG13284 / 35021 FlyBaseID:FBgn0032614 Length:339 Species:Drosophila melanogaster


Alignment Length:255 Identity:62/255 - (24%)
Similarity:104/255 - (40%) Gaps:50/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YGSALSAIGIYL--------------LRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELA 64
            |...|..||::|              |..|.|.....|..::.|:.|:|||...|||||...|||
  Fly    27 YLVGLLTIGVFLYDNLKSLVSIIKAVLEPYFQPHLPRTLVDKFGQWAVVTGATDGIGKEYARELA 91

  Fly    65 RRGATVYMACRDMKKCENARREIIKATNNQNIFARQLDLCSMKSIRNFAAG---FKREQNKL--- 123
            |:|..:.:..|..:|       :|..||.   ...|..:.:.....:||.|   :.:.:.:|   
  Fly    92 RQGINLVLISRTKEK-------LIAVTNE---IESQYKVKTKWIAADFAKGREVYDQIEKELAGI 146

  Fly   124 --HILINNAGIM-DCPK---MLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAH 182
              .||:||.|:| :.|:   :::||             .|..||.:::...:..:|.::...|..
  Fly   147 DVGILVNNVGMMYEHPESLDLVSED-------------LLWNLLTVNMGSVTMLTRKILPQMIGR 198

  Fly   183 RFGRIKRDDLNSE-KSYDRKMAYCQSKLANVLFTRELAKRLSGTGVTVNALHPGVVNTEL 241
            |.|.|.....:|| :.......|..||.....|::.|...::...:.|..:.|..|.|::
  Fly   199 RKGAIVNLGSSSELQPLPNMTVYAASKKFVTYFSKALELEVAEHNIHVQLVMPNFVVTKM 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 53/214 (25%)
NADB_Rossmann 43..317 CDD:304358 53/212 (25%)
CG13284NP_001260523.1 DltE 70..323 CDD:223377 53/212 (25%)
17beta-HSD1_like_SDR_c 70..309 CDD:187614 53/212 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447696
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.