DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and CG15629

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_608859.1 Gene:CG15629 / 33679 FlyBaseID:FBgn0031630 Length:325 Species:Drosophila melanogaster


Alignment Length:248 Identity:56/248 - (22%)
Similarity:93/248 - (37%) Gaps:42/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSAIGIYLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCEN 82
            |.:|...||.|     :|....:.:|:|.::||...|:|:...|..||..|.:.:        .:
  Fly    36 LESIYYSLLPQ-----RFRKLKDISGQVVLITGGGGGVGRLIALNFARLQARIVI--------WD 87

  Fly    83 ARREIIKAT-------NNQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAGIMDCPKM-- 138
            ..:|.||.|       ...|.....:|:...:.|...|:....|...:.||||||||:.|...  
  Fly    88 INQEAIKTTVDLLAKHGYDNCKGYVVDISDREQIYQRASQVTEEVGPVDILINNAGIVCCKPFWE 152

  Fly   139 LTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSEKSYDRKMA 203
            |.:...:....:|.:.|:......|..:..:....:|.:.|:....|.....|            
  Fly   153 LHDRVIQNTYNINIISHYWTVKAFLPHMMRNNRGHIVTVGSVTGMLGTYGCSD------------ 205

  Fly   204 YCQSKLANVLFTRELAKRLSGTG---VTVNALHPGVVNTELF-----RNTPFL 248
            |..:|.|.:.|...|...|...|   :.::.:.|..:||.:|     |..|.|
  Fly   206 YAATKYACIGFHESLLTDLKAHGYDQIQMSLICPYYINTGMFSGVRPRMMPML 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 50/225 (22%)
NADB_Rossmann 43..317 CDD:304358 50/223 (22%)
CG15629NP_608859.1 17beta-HSDXI-like_SDR_c 58..298 CDD:187598 49/221 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.