DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and rdh14b

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001040655.1 Gene:rdh14b / 334665 ZFINID:ZDB-GENE-030131-6605 Length:323 Species:Danio rerio


Alignment Length:289 Identity:146/289 - (50%)
Similarity:191/289 - (66%) Gaps:16/289 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREIIK--ATNNQNIFARQLDLCS 105
            |:..||||.|.||||.|..||.:..|.|.|||||.::.|:|.|:|..  .|:...|..:.|||.|
Zfish    41 GKTVIVTGANCGIGKATAAELLKLQARVIMACRDRQRAEDAARDIQNQAGTSQGEIVIKHLDLAS 105

  Fly   106 MKSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSA 170
            ::|:|.|.....||:.::.:||||||:..||...||:|||||:||||:||||||.||||:||.|:
Zfish   106 LQSVRRFCEEVIREEPRIDVLINNAGLYQCPYSKTEEGFEMQLGVNHLGHFLLTNLLLDLLKQSS 170

  Fly   171 PSRVVVLSSIAHRFGRIKRDDLNSEKSYDRKMAYCQSKLANVLFTRELAKRLSGTGVTVNALHPG 235
            ||||||:||..:::|.|..:|||||:||::...|.||||||:|||||||:||.||.||||||.||
Zfish   171 PSRVVVVSSKLYKYGSINFEDLNSEQSYNKSFCYSQSKLANLLFTRELARRLDGTEVTVNALTPG 235

  Fly   236 VVNTELFR--NTPFLGSWFGKLLIAPII----WIFIKTARNGAQTTLYAALDPSLEKVSGRYFSD 294
            :|.|.|.|  |.|        |||.|:.    |:|.|:...||||.||.|..|.:|.|||:.|::
Zfish   236 IVRTRLGRHVNIP--------LLIKPLFWLVSWLFFKSPLEGAQTPLYLACSPEVEGVSGKCFAN 292

  Fly   295 CKQKHVGSAAQYDDDAQFLWAESEKWTGI 323
            |:::.:.|.|..|..|:.||..||...|:
Zfish   293 CEEEQLLSKATDDHAAKRLWDLSESMVGL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 145/287 (51%)
NADB_Rossmann 43..317 CDD:304358 143/281 (51%)
rdh14bNP_001040655.1 PRK06197 41..322 CDD:235737 146/289 (51%)
NADB_Rossmann 41..315 CDD:304358 143/281 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.