DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and Mfe2

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster


Alignment Length:314 Identity:77/314 - (24%)
Similarity:124/314 - (39%) Gaps:72/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDM----------KKCENARREIIKATN 92
            |....||||:|||...|:|:|..|..|.|||.|.:  .|:          ::..:...:.|:...
  Fly     7 KLRYDGRVAVVTGAGAGLGREYALLFAERGAKVVV--NDLGGTHSGDGASQRAADIVVDEIRKAG 69

  Fly    93 NQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAGIMDCPKML--TEDGFEMQIGVNHMGH 155
            .:.:......:...|.|......|.|    :.||:|||||:....::  :|..:.:...|:..|.
  Fly    70 GEAVADYNSVIDGAKVIETAIKAFGR----VDILVNNAGILRDRSLVKTSEQDWNLVNDVHLKGS 130

  Fly   156 FLLTLLLLDVLKSSAPSRVVVLSS---IAHRFGRIKRDDLNSEKSYDRKMAYCQSKLANVLFTRE 217
            |..|......:|.....|:::.||   |...||::.               |..:|:..:    .
  Fly   131 FKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVN---------------YTAAKMGLI----G 176

  Fly   218 LAKRLSGTGVTVNALHPGVVNTELFRNTPFL--GSWFGKL---LIAPII-----------WIFIK 266
            ||..::..|...|.|...:|.|...|.|..:  ...|.:|   ||||::           ..:|:
  Fly   177 LANTVAIEGARNNVLCNVIVPTAASRMTEGILPDILFNELKPKLIAPVVAYLCHESCEDNGSYIE 241

  Fly   267 TARNGAQTTLY------AALDPSL-EKVSGRYFSD--------CKQKHVGSAAQ 305
            :|. |..|.|:      |.|.||| :.|:..|..|        .|.||:|:.|:
  Fly   242 SAA-GWATKLHMVRGKGAVLRPSLDDPVTIEYVKDVWSNVTDMSKAKHLGAIAE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 76/311 (24%)
NADB_Rossmann 43..317 CDD:304358 76/309 (25%)
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 63/274 (23%)
PRK07791 11..248 CDD:236099 61/262 (23%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.