DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and spidey

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster


Alignment Length:262 Identity:63/262 - (24%)
Similarity:104/262 - (39%) Gaps:67/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GSALSAIGIYLLRQYMQ-------GGQF---TTKTNETGRVAIVTGCNQGIGKETVLELARRGAT 69
            |.|:..:|..:.|:.:.       |.:.   :...::.|..|:|||...||||....||||||..
  Fly    14 GLAIGIVGFQVFRKVLPWIYANVVGPKVFGSSVDLSKMGEWAVVTGSTDGIGKAYAKELARRGLK 78

  Fly    70 VYMACRDMKKCENARREIIKATNNQNIFARQLDLCSMKSIRNFAAGFK-----REQN---KLHIL 126
            :.:..|.::|.....:||   .:...:..|.:|:       :|..|.:     ||:.   .:.:|
  Fly    79 LVLISRSLEKLNVVAKEI---GDKYGVEVRVIDV-------DFTGGDEIYDKIREKTTGLNVGVL 133

  Fly   127 INNAGI--------MDCPKMLTEDGFEMQI------GVNHMGHFLLTLLLLDVLKSSAPSRVVVL 177
            :||.||        :||.|  .:..|...|      .|.||     |.|.|..:.|.....::.:
  Fly   134 VNNVGISYGHPEYFLDCYK--ADPPFLRNIVAANIHSVTHM-----TALFLPGMISQRRGVIINV 191

  Fly   178 SSIAHRFGRIKRDDL---NSEKSYDRKMAYCQSKLANVLFTRELAKRLSGTGVTVNALHPGVVNT 239
            ||.|   |.|....|   :|.|::..|            |:.:|.......|:.:.::.||.|.|
  Fly   192 SSTA---GVIPNPLLSVYSSTKAFVNK------------FSDDLQTEYKEHGILIQSVQPGFVAT 241

  Fly   240 EL 241
            .:
  Fly   242 NM 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 58/226 (26%)
NADB_Rossmann 43..317 CDD:304358 58/224 (26%)
spideyNP_572420.1 PLN02780 8..321 CDD:166421 63/262 (24%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 58/224 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.