DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and CG3603

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster


Alignment Length:219 Identity:60/219 - (27%)
Similarity:103/219 - (47%) Gaps:41/219 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREIIKATNNQNIFARQLDLCSMK 107
            |:||:|||...|||:.|...|||.||.|....|::|    |.:|.::...::...|.::|:.|.:
  Fly     8 GKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLK----AAQETVQELGSERSAALEVDVSSAQ 68

  Fly   108 SIR-NFAAGFKREQNKLHILINNAGIMDCPKMLTEDGFEMQI---------GVNHMGHFLLT--- 159
            |:: :.|...|:.|....|::|:|||       |.||:.:::         |||..|.||:|   
  Fly    69 SVQFSVAEALKKFQQAPTIVVNSAGI-------TRDGYLLKMPERDYDDVYGVNLKGTFLVTQAY 126

  Fly   160 --LLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSEKSYDRKMAYCQSKLANVLFTRELAKRL 222
              .::...|::..   :|.||||..:...:.:.:            |..:|...:.||...:|..
  Fly   127 AKAMIEQKLENGT---IVNLSSIVAKMNNVGQAN------------YAATKAGVISFTEVASKEF 176

  Fly   223 SGTGVTVNALHPGVVNTELFRNTP 246
            ...|:.||.:.||.::|.:....|
  Fly   177 GKFGIRVNCILPGYIDTPMVAVVP 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 60/219 (27%)
NADB_Rossmann 43..317 CDD:304358 60/219 (27%)
CG3603NP_001259199.1 fabG 6..248 CDD:235546 60/219 (27%)
BKR_SDR_c 9..248 CDD:187594 59/218 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447719
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.