DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and Dhrs13

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_038943561.1 Gene:Dhrs13 / 303275 RGDID:1305508 Length:375 Species:Rattus norvegicus


Alignment Length:321 Identity:140/321 - (43%)
Similarity:195/321 - (60%) Gaps:20/321 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LAYGSALSAIGIYLLRQYMQ------GGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATV 70
            |..|:.| .:|.|:|..|..      ||..:.:    ||.|:|||.|.||||.|.||||||||.|
  Rat     4 LLLGAGL-LLGAYVLVYYNLVKAPPCGGIGSLR----GRTAVVTGANSGIGKMTALELARRGARV 63

  Fly    71 YMACRDMKKCENARREIIKATNNQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAGIMDC 135
            .:|||..::.|.|..::.:.:.|..:....|||.|:.|::.||..|...:.:|.|||:||||..|
  Rat    64 VLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLTSVQAFATAFLSSEPRLDILIHNAGISSC 128

  Fly   136 PKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSE-KSYD 199
            .:  |.:.|.:.:.|||:|.||||.|||..|:|.||||||::||.|||.||:....|:.. ..:.
  Rat   129 GR--TRETFNLLLRVNHVGPFLLTHLLLPRLRSCAPSRVVIVSSAAHRRGRLDFTRLDCPVVGWQ 191

  Fly   200 RKM-AYCQSKLANVLFTRELAKRLSGTGVTVNALHPGVVNTELF-RNTPFLGSWFGKLLIAPIIW 262
            ::: ||..||||||||.||||.:|.|||||..|.|||.||:||| |:.|   .|. :.::.|:.|
  Rat   192 QELRAYADSKLANVLFARELATQLEGTGVTCYAAHPGPVNSELFLRHLP---GWL-RPILRPLAW 252

  Fly   263 IFIKTARNGAQTTLYAALDPSLEKVSGRYFSDCKQKHVGSAAQYDDDAQFLWAESEKWTGI 323
            :.::..:.||||.||.||...:|.:|||||::|..:.|.:||:.|..|..||..::|..|:
  Rat   253 LVLRAPQGGAQTPLYCALQEGIEPLSGRYFANCHVEEVSAAARDDQAAHRLWKVTKKLAGL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 130/284 (46%)
NADB_Rossmann 43..317 CDD:304358 129/276 (47%)
Dhrs13XP_038943561.1 retinol-DH_like_SDR_c_like 36..304 CDD:212492 127/273 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9094
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.