DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and Cbr1

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_062043.1 Gene:Cbr1 / 29224 RGDID:2286 Length:277 Species:Rattus norvegicus


Alignment Length:294 Identity:79/294 - (26%)
Similarity:122/294 - (41%) Gaps:69/294 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VAIVTGCNQGIGKETVLELARRG-ATVYMACRDMKKCENARREIIKATNNQNIFAR--QLDLCSM 106
            ||:|||.|:|||...|.:|.|:. ..|.:..||    |:...|.:|....:.:..|  |||:.:.
  Rat     7 VALVTGANKGIGFAIVRDLCRKFLGDVVLTARD----ESRGHEAVKQLQTEGLSPRFHQLDIDNP 67

  Fly   107 KSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAP 171
            :|||.......:|...|::|:|||||  ..|::....|.:|..|....:|..|   .||.|...|
  Rat    68 QSIRALRDFLLQEYGGLNVLVNNAGI--AFKVVDPTPFHIQAEVTMKTNFFGT---QDVCKELLP 127

  Fly   172 -----SRVV-VLSSIA--------------HRFGRIKRDDL---------NSEKSYDRK-----M 202
                 .||| |.||::              .|...|..::|         :::|....|     .
  Rat   128 IIKPQGRVVNVSSSVSLRALKSCSPELQQKFRSETITEEELVGLMNKFIEDAKKGVHAKEGWPNS 192

  Fly   203 AYCQSKLANVLFTRELAKRLS----GTGVTVNALHPGVVNTELFRNTPFLGSWFGKLLIAPIIWI 263
            ||..:|:...:.:|..|::|:    ...:.:||..||.|.|:               :..|..  
  Rat   193 AYGVTKIGVTVLSRIYARKLNEERREDKILLNACCPGWVRTD---------------MAGPKA-- 240

  Fly   264 FIKTARNGAQTTLY-AALDPSLEKVSGRYFSDCK 296
             .|:...||:|.:| |.|.|..|...|::..|.|
  Rat   241 -TKSPEEGAETPVYLALLPPGAEGPHGQFVQDKK 273

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 79/294 (27%)
NADB_Rossmann 43..317 CDD:304358 79/294 (27%)
Cbr1NP_062043.1 carb_red_PTCR-like_SDR_c 7..277 CDD:187585 79/294 (27%)
adh_short 7..239 CDD:278532 66/255 (26%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P16152 95..97 0/1 (0%)