DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and Wwox

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_006255728.1 Gene:Wwox / 292041 RGDID:1309927 Length:414 Species:Rattus norvegicus


Alignment Length:315 Identity:127/315 - (40%)
Similarity:178/315 - (56%) Gaps:27/315 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YGSALSAIGIYLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMK 78
            |..:.:|:.|      :||..|      ||:|.:|||.|.|||.||....|..||.|.:|||:|.
  Rat   107 YDGSTTAMEI------LQGRDF------TGKVVLVTGANSGIGFETAKSFALHGAHVILACRNMS 159

  Fly    79 KCENARREIIKATNNQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTEDG 143
            :...|...|::..:...:.|..|||..::|:::||..||.:...||||:.|||....|..||:||
  Rat   160 RASEAVSRILEEWHKAKVEAMTLDLAVLRSVQHFAEAFKAKNVPLHILVCNAGTFALPWSLTKDG 224

  Fly   144 FEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRF-------GRIKRDDLN-SEKSYDR 200
            .|....|||:|||.|..||.|||..|||:||:|:||.:|||       |::....|: |...|..
  Rat   225 LETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSSGKLDLSRLSLSSSDYWA 289

  Fly   201 KMAYCQSKLANVLFTRELAKRLSGTGVTVNALHPG-VVNTELFRNTPFLGSWFGKLLIAPIIWIF 264
            .:||.:|||.|:||:.||.:.||..|||.|||||| ::.:.:.||     ||..|||.. :...|
  Rat   290 MLAYNRSKLCNILFSNELHRLLSPRGVTSNALHPGNMMFSAIHRN-----SWVYKLLFT-LARPF 348

  Fly   265 IKTARNGAQTTLYAALDPSLEKVSGRYFSDCKQKHVGSAAQYDDDAQFLWAESEK 319
            .|:.:.||.||:|.|:.|.||.:.|.||::|.:......||.::.|:.||..||:
  Rat   349 TKSMQQGAATTVYCAVAPELEGLGGMYFNNCCRCLPSEEAQNEETARALWELSER 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 121/288 (42%)
NADB_Rossmann 43..317 CDD:304358 118/282 (42%)
WwoxXP_006255728.1 WW 18..47 CDD:395320
WW 60..90 CDD:238122
human_WWOX_like_SDR_c-like 124..407 CDD:187669 120/286 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.