DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and SPCC736.13

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_587784.1 Gene:SPCC736.13 / 2539566 PomBaseID:SPCC736.13 Length:339 Species:Schizosaccharomyces pombe


Alignment Length:299 Identity:114/299 - (38%)
Similarity:165/299 - (55%) Gaps:33/299 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREIIKATNNQNIFARQLDLCSM 106
            ||:||:|||.:.|||..|.|||||:||.||:|.|:.:|.:...::|.....:..|...:|||...
pombe    41 TGKVALVTGSSGGIGYVTALELARKGAKVYLAGRNEEKYQKVMKQIHDEVRHSKIRFLRLDLLDF 105

  Fly   107 KSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAP 171
            :|:...|..|..::.|||||:||||||:.|..||:||:|:||..|::.|:|.|.|||..|:.:|.
pombe   106 ESVYQAAESFIAKEEKLHILVNNAGIMNPPFELTKDGYELQIQTNYLSHYLFTELLLPTLRRTAE 170

  Fly   172 S------RVVVLSSIAH---RFGRIKRDDLNSEK----SYDRKMAYCQSKLANVLFTRELAKRLS 223
            .      |:|.::|||:   .:..|...|||...    ::.|   |.|||.|.:|::..|||||.
pombe   171 ECRPGDVRIVHVASIAYLQAPYSGIYFPDLNLPHVLLGTFAR---YGQSKYAQILYSIALAKRLE 232

  Fly   224 GTGVTVNALHPGVVNTELFRNTPFLG------SWFGKLLIAPIIWIFIKTARNGAQTTLYAALDP 282
            ..|:...:|||||:.|||.|.:|...      |.|..||:.||         .||.|:||||..|
pombe   233 KYGIYSVSLHPGVIRTELTRYSPTFALKLLEKSVFQYLLLDPI---------RGAMTSLYAATSP 288

  Fly   283 SLEK--VSGRYFSDCKQKHVGSAAQYDDDAQFLWAESEK 319
            .:.|  ::|.||:...|:.:...|..|...:.|:..:.|
pombe   289 EISKEHLNGAYFTAIAQRGILHRAHDDAFVEELYRYTHK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 114/299 (38%)
NADB_Rossmann 43..317 CDD:304358 112/294 (38%)
SPCC736.13NP_587784.1 retinol-DH_like_SDR_c_like 42..322 CDD:212492 111/291 (38%)
adh_short 43..252 CDD:278532 87/211 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1484
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 184 1.000 Inparanoid score I1096
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm47252
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1905
SonicParanoid 1 1.000 - - X72
TreeFam 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.