DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and dhs-17

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001041109.1 Gene:dhs-17 / 178990 WormBaseID:WBGene00000980 Length:286 Species:Caenorhabditis elegans


Alignment Length:285 Identity:90/285 - (31%)
Similarity:134/285 - (47%) Gaps:21/285 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RVAIVTGCNQGIGKETVLELARRGAT-VYMACRDMKKCENARREIIKATNN-QNIFARQLDLCSM 106
            |..::||...||||:|.|:||..... |.:..|..:||...:..|.|...| .||.....|...:
 Worm     8 RTILITGATDGIGKQTALDLAAHPDNFVIIHGRTEEKCIATKDWIGKENGNCSNIDYVAGDFAVL 72

  Fly   107 KSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAP 171
            |.:...|...:|...:|::|:.|||::...::.|:||.|....||::.|:||..|||.|| |...
 Worm    73 KEVAIIAEEVERRFPELNVLLCNAGVLYPRRLETKDGMESTFQVNYLAHYLLCNLLLPVL-SHNR 136

  Fly   172 SRVVVLSSIAHRFGRIKRDDLNSEKSYDRKMAYCQSKLANVLFTRELAKR--LSGTGVTVNALHP 234
            |.|:|:.|:.|.:..:...|:.:.|.|::.:.|.:|||...|....|.:|  ::...|.||.:..
 Worm   137 SNVIVVGSVLHTWPSLDWADVMATKEYEKYLQYSRSKLMCHLMAFALHRRMNIARQHVNVNIIEL 201

  Fly   235 GVV----NTELFRNTPFLGSWFGKLLIAPIIWIFIKTARNGAQTTLYAALDPSLEKVSGRYFSDC 295
            |..    |....|.|..|.|....|.|.       :.|.|.||    ....|.|||:||:|....
 Worm   202 GKEKEPNNNGKLRTTSALSSSMSTLSIC-------RQAGNLAQ----LIEGPCLEKISGKYLDPS 255

  Fly   296 -KQKHVGSAAQYDDDAQFLWAESEK 319
             ||...||.|..:...:.|||.|::
 Worm   256 GKQMRSGSDATDERLQERLWAYSKE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 90/285 (32%)
NADB_Rossmann 43..317 CDD:304358 89/281 (32%)
dhs-17NP_001041109.1 retinol-DH_like_SDR_c_like 7..275 CDD:212492 86/278 (31%)
PRK06197 8..281 CDD:235737 90/285 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.