DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and dhs-8

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001022250.1 Gene:dhs-8 / 175108 WormBaseID:WBGene00000972 Length:379 Species:Caenorhabditis elegans


Alignment Length:290 Identity:95/290 - (32%)
Similarity:146/290 - (50%) Gaps:18/290 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREIIKATNNQNIFARQLDLCSM 106
            :|:...:||...|||..|...||..||.|.:..|::.:.||.::.|::...:..:.....||..:
 Worm    84 SGKTFAITGTTSGIGINTAEVLALAGAHVVLMNRNLHESENQKKRILEKKPSAKVDIIFCDLSDL 148

  Fly   107 KSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAP 171
            |::|.....:..:...:|.||.|||:.......|:||||...|||.:.||.|..:||.|::.|||
 Worm   149 KTVRKAGEDYLAKNWPIHGLILNAGVFRPAAAKTKDGFESHYGVNVVAHFTLLRILLPVVRRSAP 213

  Fly   172 SRVVVLSSIAHRFGRIKRDDLNSEK---------SYDRKMAYCQSKLANVLFTRELAKRLSGTGV 227
            ||||.|||........|:....|||         |......|..||:|::|...:|.:.....|:
 Worm   214 SRVVFLSSTLSSKHGFKKSMGISEKMSILQGEDSSASTLQMYGASKMADMLIAFKLHRDEYKNGI 278

  Fly   228 TVNALHPGV-VNTELFRNTPFLGSWFGKLLIAPIIWIFIKTARNGAQTTLYAALDPSLEKVSGRY 291
            :..::|||. |.|::|||: .||.:.| .:..|    |.|.|..||.||:|.|..|.:||:||:|
 Worm   279 STYSVHPGSGVRTDIFRNS-LLGKFIG-FVTTP----FTKNASQGAATTVYCATHPEVEKISGKY 337

  Fly   292 FSDC--KQKHVGSAAQYDDDAQFLWAESEK 319
            :..|  ..|.....|:.::..:.||.:.|:
 Worm   338 WESCWDNDKIDKKTARDEELQEALWKKLEQ 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 95/290 (33%)
NADB_Rossmann 43..317 CDD:304358 94/285 (33%)
dhs-8NP_001022250.1 PRK06196 68..362 CDD:235736 92/283 (33%)
NADB_Rossmann 85..362 CDD:304358 92/282 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.