DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and dhs-7

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_495500.1 Gene:dhs-7 / 174183 WormBaseID:WBGene00000971 Length:329 Species:Caenorhabditis elegans


Alignment Length:299 Identity:92/299 - (30%)
Similarity:146/299 - (48%) Gaps:30/299 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREIIKATNNQNIFARQLDLC 104
            |..|:..:|||...|||.||...|:..||.|.|..|::::.|..:::|::..|:..|...:.||.
 Worm    25 NLAGKTFVVTGTTSGIGIETARSLSLNGAHVVMLNRNLEESEKLKKKIVEEMNDAEIDIIECDLN 89

  Fly   105 SMKSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSS 169
            |:.|::..|..:..::..:|.||.|||:.......|.||.|....:||:.||||...||.:::.|
 Worm    90 SLHSVKKAAEVYISKKWSIHCLILNAGVFGTASKTTVDGLESHFAINHLSHFLLIQELLPIVRQS 154

  Fly   170 APSRVVVLSSIAHRFGRIKRD------------DLNSEKSYDRKMAYCQSKLANVLFTRELAKRL 222
            .|||:|::||..|....:..:            :.:|:.|:.|  .|.:||:.|:|...:|.:..
 Worm   155 IPSRIVLVSSSVHATCGVSPEMSIEEKLKILCPESSSDASWFR--LYSRSKMCNMLVAFKLHRDE 217

  Fly   223 SGTGVTVNALHPG-VVNTELFRNTPFLGSW---FGKLLIAPIIWIFIKTARNGAQTTLYAALDPS 283
            ...|::..::||| .|.|.:||:     ||   ...:|..|    |.|....||.||:|.|..|.
 Worm   218 YHNGISTYSVHPGNGVRTSIFRD-----SWLVSIASILSTP----FTKNISQGASTTVYCAGHPE 273

  Fly   284 LEKVSGRYFSDCKQKHVGSAAQYDDDAQF---LWAESEK 319
            :..|||:|:........|...:...|.|.   ||..|:|
 Worm   274 VANVSGKYWDSNWDDEKGLYEEVARDEQLQDALWKHSDK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 91/298 (31%)
NADB_Rossmann 43..317 CDD:304358 89/292 (30%)
dhs-7NP_495500.1 PRK06197 28..313 CDD:235737 91/296 (31%)
retinol-DH_like_SDR_c_like 28..307 CDD:212492 87/289 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D921996at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.