DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and DHRS13

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_653284.2 Gene:DHRS13 / 147015 HGNCID:28326 Length:377 Species:Homo sapiens


Alignment Length:327 Identity:143/327 - (43%)
Similarity:189/327 - (57%) Gaps:32/327 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LAYGSALSAIGIYLLRQYMQ------GGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATV 70
            |..|:.| .:|.|:|..|..      ||.    .|..||.|:|||.|.||||.|.||||||||.|
Human     4 LLLGAGL-LLGAYVLVYYNLVKAPPCGGM----GNLRGRTAVVTGANSGIGKMTALELARRGARV 63

  Fly    71 YMACRDMKKCENARREIIKATNNQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAGIMDC 135
            .:|||..::.|.|..::.:.:.|..:....|||.|:.|:|.||..|...:.:|.|||:||||..|
Human    64 VLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSC 128

  Fly   136 PKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSEKSYDR 200
            .:  |.:.|.:.:.|||:|.||||.|||..||:.|||||||::|.||..||:      ..|..||
Human   129 GR--TREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVASAAHCRGRL------DFKRLDR 185

  Fly   201 KM--------AYCQSKLANVLFTRELAKRLSGTGVTVNALHPGVVNTELF-RNTPFLGSWFGKLL 256
            .:        ||..:|||||||.||||.:|..||||..|.|||.||:||| |:.|   .|. :.|
Human   186 PVVGWRQELRAYADTKLANVLFARELANQLEATGVTCYAAHPGPVNSELFLRHVP---GWL-RPL 246

  Fly   257 IAPIIWIFIKTARNGAQTTLYAALDPSLEKVSGRYFSDCKQKHVGSAAQYDDDAQFLWAESEKWT 321
            :.|:.|:.::..|.||||.||.||...:|.:|||||::|..:.|..||:.|..|..||..|::..
Human   247 LRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHRLWEASKRLA 311

  Fly   322 GI 323
            |:
Human   312 GL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 132/290 (46%)
NADB_Rossmann 43..317 CDD:304358 131/282 (46%)
DHRS13NP_653284.2 retinol-DH_like_SDR_c_like 36..304 CDD:212492 129/279 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..377 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.