DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and RDH13

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001139443.1 Gene:RDH13 / 112724 HGNCID:19978 Length:331 Species:Homo sapiens


Alignment Length:312 Identity:167/312 - (53%)
Similarity:210/312 - (67%) Gaps:6/312 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSAIG-----IYLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDM 77
            |||:|     ..||:.|:.||...:|....|:..||||.|.||||:|.|||||||..:.:|||||
Human     8 LSALGTVAGAAVLLKDYVTGGACPSKATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRDM 72

  Fly    78 KKCENARREIIKATNNQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTED 142
            :|||.|.::|...|.|.::.||.|||.|:||||.|||....|:.::.|||||||:|.||...|||
Human    73 EKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHWTTED 137

  Fly   143 GFEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLN-SEKSYDRKMAYCQ 206
            |||||.||||:||||||.||||.||:|||||::.|||:||..|.|..|||| ..:.|:.|.||||
Human   138 GFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRKYNTKAAYCQ 202

  Fly   207 SKLANVLFTRELAKRLSGTGVTVNALHPGVVNTELFRNTPFLGSWFGKLLIAPIIWIFIKTARNG 271
            ||||.||||:||::||.|:|||||||||||..|||.|:|...||.|....:.||.|:.:|:....
Human   203 SKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHTGIHGSTFSSTTLGPIFWLLVKSPELA 267

  Fly   272 AQTTLYAALDPSLEKVSGRYFSDCKQKHVGSAAQYDDDAQFLWAESEKWTGI 323
            ||.:.|.|:...|..|||:||...|||.....|:.::.|:.|||||.:..|:
Human   268 AQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARRLWAESARLVGL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 156/282 (55%)
NADB_Rossmann 43..317 CDD:304358 154/274 (56%)
RDH13NP_001139443.1 retinol-DH_like_SDR_c 38..313 CDD:212495 154/274 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 251 1.000 Domainoid score I2108
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 316 1.000 Inparanoid score I2553
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm41333
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1905
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.