DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and Cbr3

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_766635.1 Gene:Cbr3 / 109857 MGIID:1309992 Length:277 Species:Mus musculus


Alignment Length:286 Identity:80/286 - (27%)
Similarity:121/286 - (42%) Gaps:80/286 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RVAIVTGCNQGIGKETVLELARR-GATVYMACRDMKKCENARREIIKATNNQNIFAR--QLDLCS 105
            |||:|||.|:|||.....:|.|: ...|.:..||    |...|..::....:.:..|  |||:..
Mouse     6 RVALVTGANKGIGFAITRDLCRKFSGDVVLTARD----EARGRAAVQQLQAEGLSPRFHQLDIDD 66

  Fly   106 MKSIRNFAAGFKREQNKLHILINNAGI---MDCPKMLTEDGFEMQIGVNHMGHFLLT----LLLL 163
            .:|||......::|...|::|:|||||   ||.|     ..|::|..|....:|..|    ..||
Mouse    67 PQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDP-----TPFDIQAEVTLKTNFFATRNVCTELL 126

  Fly   164 DVLKSSAPSRVVVLSSIAHRFGRIK-----RDDLNSE------------------------KSYD 199
            .::|..  .|||.:||:.    .:|     |:||..:                        :.::
Mouse   127 PIMKPH--GRVVNISSLQ----GLKALENCREDLQEKFRCDTLTEVDLVDLMKKFVEDTKNEVHE 185

  Fly   200 RK----MAYCQSKLANVLFTRELAKRL----SGTGVTVNALHPGVVNTELFRNTPFLGSWFGKLL 256
            |:    .||..|||...:.||.||::|    ....:.:||..||.|.|::.|:.   ||      
Mouse   186 REGWPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQ---GS------ 241

  Fly   257 IAPIIWIFIKTARNGAQTTLYAALDP 282
                     :|...||:|.:|.||.|
Mouse   242 ---------RTVEEGAETPVYLALLP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 80/286 (28%)
NADB_Rossmann 43..317 CDD:304358 80/286 (28%)
Cbr3NP_766635.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 80/286 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.