DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and AT1G64590

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_176640.1 Gene:AT1G64590 / 842767 AraportID:AT1G64590 Length:334 Species:Arabidopsis thaliana


Alignment Length:295 Identity:106/295 - (35%)
Similarity:160/295 - (54%) Gaps:28/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IVTGANTGIGKETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQESIRH 113
            |:|||.:|||.||.|.:||||..:.:..|::|..||.:..|:.|..:..:.....||:|..|:|.
plant    38 IITGATSGIGAETARVLAKRGARLVLPARSVKTAEETKARILSEFPDAEIIVMHLDLSSLTSVRR 102

  Fly   114 FVAAFKREQEHLHVLINNAGVMRCPRSLTSDGIELQLGVNHMGHFLLTNLLLDLLKKSS-----P 173
            ||..|:.....|::||||||......:|:.||:|:....|::||||||.|||..:.:::     .
plant   103 FVDDFESLNLPLNILINNAGKYAHKHALSEDGVEMTFATNYLGHFLLTKLLLKKMIETAAQTGVQ 167

  Fly   174 SRIVNVSSLAHTRGEINTGDL--------NSDKSYDEGKAYSQSKLANVLFTRELAKRLE--GTN 228
            .|||||:|:.|:   ..:||:        .::::||..:||:.|||||||.|.||::.|.  ..|
plant   168 GRIVNVTSVVHS---WFSGDMLQYLADISRNNRNYDATRAYALSKLANVLHTVELSRLLHKMDAN 229

  Fly   229 VTANALHPGVVDTEIIRHMGFFNNFFAGLFVKPLFW---PFVKTPRNGAQTSLYVALDPELEKVT 290
            ||||.:|||:|.|.:.|..       .|:....:|:   ..:|:....|.|:.|||..|.|..|.
plant   230 VTANCVHPGIVKTRLTRDR-------EGVVTDLVFFLTSKLLKSVPQAAATTCYVATSPRLRNVC 287

  Fly   291 GQYFSDCKLKEMAPAATDTQTAKWLWAVSEKWTKP 325
            |:|||||.....:.:.:....|:.||..|:....|
plant   288 GKYFSDCNEARSSKSGSCNLKAQRLWTASDLLVSP 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 105/291 (36%)
NADB_Rossmann 45..319 CDD:304358 104/287 (36%)
AT1G64590NP_176640.1 retinol-DH_like_SDR_c_like 36..313 CDD:212492 102/284 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm1091
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.