DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and dhrs12la

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_987120.1 Gene:dhrs12la / 677747 ZFINID:ZDB-GENE-030131-8104 Length:320 Species:Danio rerio


Alignment Length:309 Identity:108/309 - (34%)
Similarity:165/309 - (53%) Gaps:33/309 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLFA----FLKSRTAF----WLSFTGTTTGLAFFVKDLMQGGQFTKETNETGKVFIVTGANTGI 57
            |||:.    |||..|.|    :||.:..     |..|||        ||:..|:.|::||||:||
Zfish     1 MSLYRNSAWFLKGLTEFTKGAFLSASKN-----FVEKDL--------ETSMAGRSFMITGANSGI 52

  Fly    58 GKETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQESIRHFVAAFKREQ 122
            ||.....|||:||||:|.|||..|.||||.|||.|:.||.:|....||:..:.:..||.:||::.
Zfish    53 GKAAAMAIAKKGGTVHMVCRNKDKAEEARAEIVKESGNKEIYVHILDLSETKKVWEFVESFKKKY 117

  Fly   123 EHLHVLINNAGVMRCPRSLTSDGIELQLGVNHMGHFLLTNLLLDLLKKSSPSRIVNVSSLAHTRG 187
            :.|:|||||||.|...|.:..:|:|.....|.:..|:....|:.||:||...|::.|||......
Zfish   118 KTLNVLINNAGCMMTKREVNGEGLEKSFASNSLAVFIFIKSLIPLLEKSPDPRVITVSSGGMLVQ 182

  Fly   188 EINTGDLNSDKS-YDEGKAYSQSKLANVLFTRELAKRLEGTNVTANALHPGVVDTEIIRHMGFFN 251
            ::.||:|.|.:. ||....|:|:|...|:.|.:.||  ...::..:.:|||.|||..|.:.  ..
Zfish   183 KLRTGNLQSQRGRYDGTMVYAQNKRQQVVMTEQFAK--AHPSIHFSVMHPGWVDTPTIANA--MP 243

  Fly   252 NFFAGLFVKPLFWPFVKTPRNGAQTSLYVALDPELEK-VTGQYFSDCKL 299
            :|.:.:..:      ::|...||.|.:::|:.....| .:|:::.|.|:
Zfish   244 DFHSSMKER------LRTTEQGADTVVWLAVSEAAAKNPSGRFYQDRKM 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 92/259 (36%)
NADB_Rossmann 45..319 CDD:304358 92/257 (36%)
dhrs12laNP_987120.1 FabG 37..273 CDD:223959 88/245 (36%)
DHRS-12_like_SDR_c-like 40..294 CDD:187668 92/257 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.