DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and WWOX

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_057457.1 Gene:WWOX / 51741 HGNCID:12799 Length:414 Species:Homo sapiens


Alignment Length:339 Identity:128/339 - (37%)
Similarity:183/339 - (53%) Gaps:43/339 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLKSRTAFWLS-----------FTGTTTGLAFFVKDLMQGGQFTKETNETGKVFIVTGANTGIGK 59
            :|..|.||.:.           :.|:||.:     :::||..|      ||||.:|||||:|||.
Human    85 YLDPRLAFTVDDNPTKPTTRQRYDGSTTAM-----EILQGRDF------TGKVVVVTGANSGIGF 138

  Fly    60 ETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQESIRHFVAAFKREQEH 124
            ||.:..|..|..|.:||||:.:..||...|:.|.....|.....|||...|::||..|||.:...
Human   139 ETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLDLALLRSVQHFAEAFKAKNVP 203

  Fly   125 LHVLINNAGVMRCPRSLTSDGIELQLGVNHMGHFLLTNLLLDLLKKSSPSRIVNVSSLAHTRGEI 189
            ||||:.||.....|.|||.||:|....|||:|||.|..||.|:|.:|:|:|::.|||.:|...:|
Human   204 LHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDI 268

  Fly   190 N--TGDLN------SDKSYDEGKAYSQSKLANVLFTRELAKRLEGTNVTANALHPGVVDTEIIRH 246
            |  .|.|:      :...|....||::|||.|:||:.||.:||....||:||:|||.:       
Human   269 NDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNM------- 326

  Fly   247 MGFFNNFFAGLFVKPLFW----PFVKTPRNGAQTSLYVALDPELEKVTGQYFSDCKLKEMAPAAT 307
              .::|.....:|..|.:    ||.|:.:.||.|::|.|..||||.:.|.||::|.....:|.|.
Human   327 --MYSNIHRSWWVYTLLFTLARPFTKSMQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQ 389

  Fly   308 DTQTAKWLWAVSEK 321
            ..:||:.|||:||:
Human   390 SEETARTLWALSER 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 118/291 (41%)
NADB_Rossmann 45..319 CDD:304358 115/285 (40%)
WWOXNP_057457.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
WW 19..47 CDD:238122
Nuclear localization signal. /evidence=ECO:0000250 50..55
WW 60..90 CDD:238122 1/4 (25%)
human_WWOX_like_SDR_c-like 124..407 CDD:187669 117/289 (40%)
Interaction with MAPT. /evidence=ECO:0000250 125..414 116/288 (40%)
Mediates targeting to the mitochondria. /evidence=ECO:0000250 209..273 29/63 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.