Sequence 1: | NP_001260784.1 | Gene: | CG30491 / 35704 | FlyBaseID: | FBgn0050491 | Length: | 331 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057455.1 | Gene: | HSD17B7 / 51478 | HGNCID: | 5215 | Length: | 341 | Species: | Homo sapiens |
Alignment Length: | 304 | Identity: | 70/304 - (23%) |
---|---|---|---|
Similarity: | 116/304 - (38%) | Gaps: | 73/304 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 KVFIVTGANTGIGKETVREIAKRGGTVY--MACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQ 108
Fly 109 ESIRHFVAAFKREQEHLHVLINNAGVMRCPR------------------------------SLTS 143
Fly 144 DGIELQLGVNHMGHFLLTNLLLDLLKKS-SPSRIVNVSSLAHTRGEINTGDLNSDKSYDEGK-AY 206
Fly 207 SQSKLANVLFTRELAKRLEGTNVTANALHPGVVDTEIIRHMGFFNNFFAGLFVKPLFW------- 264
Fly 265 --------PFVKTPRNGAQTSLYV------ALDP---ELEKVTG 291 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30491 | NP_001260784.1 | PRK06197 | 43..323 | CDD:235737 | 70/304 (23%) |
NADB_Rossmann | 45..319 | CDD:304358 | 70/304 (23%) | ||
HSD17B7 | NP_057455.1 | 3KS_SDR_c | 2..280 | CDD:187645 | 65/291 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S4278 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.860 |