DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and HSD17B7

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_057455.1 Gene:HSD17B7 / 51478 HGNCID:5215 Length:341 Species:Homo sapiens


Alignment Length:304 Identity:70/304 - (23%)
Similarity:116/304 - (38%) Gaps:73/304 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KVFIVTGANTGIGKETVREIAKRGGTVY--MACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQ 108
            ||.::|||::|||....:.:......::  :||||:.|.|.....::.......|...|.|:::.
Human     3 KVVLITGASSGIGLALCKRLLAEDDELHLCLACRNMSKAEAVCAALLASHPTAEVTIVQVDVSNL 67

  Fly   109 ESIRHFVAAFKREQEHLHVLINNAGVMRCPR------------------------------SLTS 143
            :|:.......|:..:.|..:..|||:|..|:                              .:|:
Human    68 QSVFRASKELKQRFQRLDCIYLNAGIMPNPQLNIKALFFGLFSRKVIHMFSTAEGLLTQGDKITA 132

  Fly   144 DGIELQLGVNHMGHFLLTNLLLDLLKKS-SPSRIVNVSSLAHTRGEINTGDLNSDKSYDEGK-AY 206
            ||::.....|..|||:|...|..||..| :||:::..||.:..:...:..|....|    || .|
Human   133 DGLQEVFETNVFGHFILIRELEPLLCHSDNPSQLIWTSSRSARKSNFSLEDFQHSK----GKEPY 193

  Fly   207 SQSKLANVLFTRELAKRLEGTNVTANALHPGVVDTEIIRHMGFFNNFFAGLFVKPLFW------- 264
            |.||.|..|.:..|.:......:.:|...||...|          |...|: :.|..|       
Human   194 SSSKYATDLLSVALNRNFNQQGLYSNVACPGTALT----------NLTYGI-LPPFIWTLLMPAI 247

  Fly   265 --------PFVKTPRNGAQTSLYV------ALDP---ELEKVTG 291
                    .|..||.||.:..:::      :|:|   .|...||
Human   248 LLLRFFANAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 70/304 (23%)
NADB_Rossmann 45..319 CDD:304358 70/304 (23%)
HSD17B7NP_057455.1 3KS_SDR_c 2..280 CDD:187645 65/291 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4278
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.