DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and dhrs13

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_989311.1 Gene:dhrs13 / 394935 XenbaseID:XB-GENE-1006231 Length:314 Species:Xenopus tropicalis


Alignment Length:302 Identity:132/302 - (43%)
Similarity:191/302 - (63%) Gaps:10/302 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LAFFVKDLMQGGQFTKETNETGKVFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKCEEAREE 88
            |.:|  :|::|.|...:.:..||..||||||.||||.|..::||||..|.:|||..:..|.|..:
 Frog    17 LIYF--NLIRGRQCRSDASLKGKTVIVTGANVGIGKMTALDMAKRGARVILACRVKETGEAAAYD 79

  Fly    89 IVLETKNKYVYCRQCDLASQESIRHFVAAFKREQEHLHVLINNAGVMRCPRSLTSDGIELQLGVN 153
            |...:.|..|...:.||||.||:|.|..||...:..|.:||||||:....:  |::|..:..|||
 Frog    80 IRKLSGNNQVVFMKLDLASLESVRSFCRAFLSSEPRLDILINNAGLSGFGK--TAEGYNIVFGVN 142

  Fly   154 HMGHFLLTNLLLDLLKKSSPSRIVNVSSLAHTRGEINTGDLN--SDKSYDEGKAYSQSKLANVLF 216
            |:||||||:||||.||:|:|||||.::|.||..|:|:...::  |:...|..::|..|||.||||
 Frog   143 HLGHFLLTSLLLDRLKQSTPSRIVVLASYAHEWGKIDFNKISVPSEHVKDTLQSYCDSKLCNVLF 207

  Fly   217 TRELAKRLEGTNVTANALHPGVVDTEIIRHMGFFNNFFAGLFVKPLFWPFVKTPRNGAQTSLYVA 281
            .||||.||:||:||..::|||.|.|.:.|.:    ..:..:.::|:.|.|::||.||||||:|.|
 Frog   208 ARELANRLQGTSVTCYSVHPGTVHTNLARSL----PSWIKVLIEPVSWLFLRTPMNGAQTSIYCA 268

  Fly   282 LDPELEKVTGQYFSDCKLKEMAPAATDTQTAKWLWAVSEKWT 323
            :...:|..:|:||.:|:::::.|.|.|...||.||.|||:.|
 Frog   269 VQEGIEMYSGRYFDNCQVRQVKPHARDDAVAKKLWEVSERMT 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 126/281 (45%)
NADB_Rossmann 45..319 CDD:304358 123/275 (45%)
dhrs13NP_989311.1 NADB_Rossmann 36..306 CDD:389744 123/275 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9257
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.