DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and C2orf81

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001303693.1 Gene:C2orf81 / 388963 HGNCID:34350 Length:615 Species:Homo sapiens


Alignment Length:133 Identity:33/133 - (24%)
Similarity:49/133 - (36%) Gaps:32/133 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LTSDGIELQLGV-NHMGHFLLTN-LLLDLLKKSSPSRIVNV------SSLAHTRGEINTG----- 192
            |:|..:|.:|.: |....||.|: :|.|:.:..||....:|      ...|...||:..|     
Human   461 LSSPSLESKLPLPNSRIRFLTTHPVLPDVARSRSPKLWPSVRWPSGWEGKAELLGELWAGRTRVP 525

  Fly   193 ----DLNSDKSYDEGK----------AYSQSKLANVLFTRELAKRLEGTNV----TANALHPGVV 239
                :|...:..|.|:          |.||.....||.. |..|...|.::    |...|..||.
Human   526 PQGLELADREGQDPGRWPRTTPPVLEATSQVMWKPVLLP-EALKLAPGVSMWNRSTQVLLSSGVP 589

  Fly   240 DTE 242
            :.|
Human   590 EQE 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 33/133 (25%)
NADB_Rossmann 45..319 CDD:304358 33/133 (25%)
C2orf81NP_001303693.1 DUF4639 9..614 CDD:292118 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.