DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and cbr1

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_919387.1 Gene:cbr1 / 373866 ZFINID:ZDB-GENE-030902-2 Length:276 Species:Danio rerio


Alignment Length:293 Identity:80/293 - (27%)
Similarity:119/293 - (40%) Gaps:61/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KVFIVTGANTGIGKETVREIAKR-GGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQE 109
            ||.:|||||.|||...||.:.|. .|.||::.|::.:...|.:.  |:.:..:....|.|:....
Zfish     5 KVALVTGANKGIGFAIVRALCKEYTGDVYLSSRDVGRGTAAVDS--LKKEGLHPLFHQLDINDPN 67

  Fly   110 SIRHFVAAFKREQEHLHVLINNAGVMRCPRSLTSDG--IELQLGVNHMGHFLLTNLLLDLLKKSS 172
            |:|.....|:.:...|.|||||||:.......|..|  .::.|..|......:.|:.|.::|.. 
Zfish    68 SVRTARDFFQEKYGGLDVLINNAGIAFKMADTTPFGTQADVTLKTNFFATRDMCNVFLPIIKPG- 131

  Fly   173 PSRIVNVSS------LAHTRGEINTGDLNSDKSYDE-----------------------GKAYSQ 208
             .|:|||||      |.....|:.....:.|.:.:|                       ..||..
Zfish   132 -GRLVNVSSGMGSMALGRCSPELQARFRSDDITEEELNGLMERFVREAQEGVHSERGWPSTAYGI 195

  Fly   209 SKLANVLFT----RELAKRLEGTNVTANALHPGVVDTEIIRHMGFFNNFFAGLFVKPLFWP-FVK 268
            ||......|    |.|.|...|..:..||..||.|.|::           ||        | ..|
Zfish   196 SKTGLTTLTRIQARNLTKERPGDGILCNACCPGWVRTDM-----------AG--------PNATK 241

  Fly   269 TPRNGAQTSLYVALDPE-LEKVTGQYFSDCKLK 300
            :|..||.|.:|:||.|. .::..||:.|:.|::
Zfish   242 SPDEGAITPVYLALLPAGAKEPHGQFVSEMKVQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 80/293 (27%)
NADB_Rossmann 45..319 CDD:304358 80/293 (27%)
cbr1NP_919387.1 carb_red_PTCR-like_SDR_c 5..276 CDD:187585 80/293 (27%)
adh_short 5..237 CDD:278532 66/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.