DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and F32A5.8

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_495516.2 Gene:F32A5.8 / 353400 WormBaseID:WBGene00017971 Length:257 Species:Caenorhabditis elegans


Alignment Length:230 Identity:77/230 - (33%)
Similarity:117/230 - (50%) Gaps:18/230 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KETNETGKVFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQC 103
            ||.:.:||.:.:||..:|||.||.|.:|.:|..|.|..||:.:.|:.::.|..|..:..:....|
 Worm    30 KEIDLSGKTYAITGTTSGIGIETARALALKGAHVVMFNRNIVESEKLKKRIEEEKPDVKIDFISC 94

  Fly   104 DLASQESIRHFVAAFKREQEHLHVLINNAGVMRCPRSLTSDGIELQLGVNHMGHFLLTNLLLDLL 168
            ||.|.:|.:.....|..:...||.||.||||.......|.|..|...||||:..|||...||..|
 Worm    95 DLNSLQSAKAAADEFLSKHWPLHGLILNAGVFAPTVKFTFDNFESHFGVNHLAQFLLAKELLPAL 159

  Fly   169 KKSSPSRIVNVSSL--AHT--RGEINTGDL-------NSDKSYDEGKAYSQSKLANVLFTRELAK 222
            ::|||:|||.|||:  :||  :.|:...:.       |:::.|  .|.|:.||:..||...::.:
 Worm   160 RQSSPARIVFVSSVSSSHTGLKAEMTRSEKLNKLCPENANEFY--YKLYAYSKMCQVLTAFKIHR 222

  Fly   223 -RLEGTNVTANALHPG-VVDTEIIR---HMGFFNN 252
             ......::..|:||| ::.|.||.   |:....|
 Worm   223 DEFVSHGISTYAIHPGTMIGTGIILFQFHIALHTN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 75/226 (33%)
NADB_Rossmann 45..319 CDD:304358 75/224 (33%)
F32A5.8NP_495516.2 NADB_Rossmann 36..>245 CDD:304358 71/210 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.