DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and CG6012

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster


Alignment Length:263 Identity:63/263 - (23%)
Similarity:99/263 - (37%) Gaps:62/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLFAFLKSRTAFWL----SFTGTTTGLAFFVKDLMQGGQFTKETNETGKVFIVTGANTGIGKET 61
            :|.:.:.:.||.:.|    .|:||...|              ||  ..|....||||:.|||||.
  Fly    17 LSSYLYEQLRTPYKLIKIRYFSGTRPTL--------------KE--RFGDWAAVTGASDGIGKEY 65

  Fly    62 VREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQESIRHFVAAFKREQ---E 123
            .:|:|::...|.:..|..:|.:...:||.           .|....|..|  .:|.|.:..   |
  Fly    66 AKELARQNINVVLIARTEEKLQAVAKEIA-----------DCGAGVQTKI--VIADFTKGSQVYE 117

  Fly   124 HLH---------VLINNAGVMRCPRSL---TSDGIELQLGVNHMGHFLLTNLLLDLLKKSS-PSR 175
            |:.         :|:||.|: ..|:||   ..:..:..:..|.:....|:.:....:|.|. ...
  Fly   118 HIEKETANIPISILVNNVGI-ATPKSLLKYNQEETQNIIDTNVVAVSQLSRIFFQRMKASKLKGA 181

  Fly   176 IVNVSSLAHTRGEINTGDLNSDKSYDEGKAYSQSKLANVLFTRELAKRLEGTNVTANALHPGVVD 240
            ||||.|....:      .|.:...|...|||::|      .|..|....:...:....|.|..|.
  Fly   182 IVNVGSGTELQ------PLPNGAYYAASKAYTRS------LTLALYHEAKPYGIHVQMLSPNFVV 234

  Fly   241 TEI 243
            |:|
  Fly   235 TKI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 53/217 (24%)
NADB_Rossmann 45..319 CDD:304358 53/215 (25%)
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 53/215 (25%)
adh_short 51..243 CDD:278532 52/213 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447699
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.