DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and CG31809

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster


Alignment Length:278 Identity:67/278 - (24%)
Similarity:109/278 - (39%) Gaps:69/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLFAFLKSRTAFWLSFTGTTTGLAFFVKDLMQGGQFTKETNETGKVFIVTGANTGIGKETVREIA 66
            |||:.:||...            .||..:|.:     ....:.|...:||||..|||||..||:|
  Fly    22 SLFSIIKSVVE------------PFFRPNLPK-----TLAEKFGNWAVVTGATDGIGKEYARELA 69

  Fly    67 KRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQES--IRHFVAAFKREQE---HLH 126
            ::|..:.:..|        :||.::...|        ::.||.:  |:..||.|.:.:|   |:.
  Fly    70 RQGLNLVLVSR--------KEEKLIAVTN--------EIGSQYNVKIKWIVADFAKGREVYAHIE 118

  Fly   127 ---------VLINNAGVMRCPRSL---TSDGIELQLGVNHMGHFLLTNLLLDLLKKSSPSRIVNV 179
                     :|:||.|.:..|.||   :.|.:...|.||.....:||..:|..:.......|||:
  Fly   119 KELNGIEVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNL 183

  Fly   180 SSLAHTRGEINTGDLNSDKSYDEGKAYSQSKLANVLFTRELAKRLEGTNVTANALHPGVVDTEI- 243
            .|.:..:...|.            .||:.:|.....||:.|...:...|:....:.|..|.|.: 
  Fly   184 GSSSELQPHPNL------------TAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMN 236

  Fly   244 -----IRHMG-FFNNFFA 255
                 :|..| .|.|.::
  Fly   237 SYSDKVRQGGLLFPNAYS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 59/237 (25%)
NADB_Rossmann 45..319 CDD:304358 59/235 (25%)
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 59/235 (25%)
DltE 50..302 CDD:223377 58/233 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.