DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and Cbr3

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001100580.1 Gene:Cbr3 / 304078 RGDID:1309728 Length:277 Species:Rattus norvegicus


Alignment Length:291 Identity:79/291 - (27%)
Similarity:124/291 - (42%) Gaps:65/291 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KVFIVTGANTGIGKETVREIAKR-GGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQE 109
            :|.:|||||.|||....|::.:: .|.|.:..|:..:...|.:::..|..:...:  |.|:.:.:
  Rat     6 RVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVKQLQAEGLSPRFH--QLDIDNPQ 68

  Fly   110 SIRHFVAAFKREQEHLHVLINNAGV---MRCPRSLTSDGIELQLGVNHMGHFLLT-NLLLDLLKK 170
            |||......::|...|:||:||||:   |..|..     .::|..|....:|..| |:..:||..
  Rat    69 SIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTP-----FDVQAEVTLKTNFFATRNVCTELLPI 128

  Fly   171 SSP-SRIVNVSSLAHTRG---------------EINTGDL-----------NSDKSYDEG---KA 205
            ..| .|:||||||...:.               .:..|||           .::....||   .|
  Rat   129 MKPHGRVVNVSSLQGLKALENCSEDLQERFRCDTLTEGDLVDLMKKFVEDTKNEVHEREGWPDSA 193

  Fly   206 YSQSKLANVLFTRELAKRLE----GTNVTANALHPGVVDTEIIRHMGFFNNFFAGLFVKPLFWPF 266
            |..|||...:.||.||::|:    ...:..||..||.|.|::.|..|                  
  Rat   194 YGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQG------------------ 240

  Fly   267 VKTPRNGAQTSLYVA-LDPELEKVTGQYFSD 296
            .:|...||:|.:|:| |.|:..:..||...|
  Rat   241 SRTVEEGAETPVYLALLPPDATEPHGQLVRD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 79/291 (27%)
NADB_Rossmann 45..319 CDD:304358 79/291 (27%)
Cbr3NP_001100580.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 79/291 (27%)
adh_short 6..241 CDD:278532 68/259 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.