DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and Cbr1

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_062043.1 Gene:Cbr1 / 29224 RGDID:2286 Length:277 Species:Rattus norvegicus


Alignment Length:296 Identity:79/296 - (26%)
Similarity:125/296 - (42%) Gaps:69/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VFIVTGANTGIGKETVREIAKRG-GTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQES 110
            |.:|||||.|||...||::.::. |.|.:..|:..:..||.::  |:|:.......|.|:.:.:|
  Rat     7 VALVTGANKGIGFAIVRDLCRKFLGDVVLTARDESRGHEAVKQ--LQTEGLSPRFHQLDIDNPQS 69

  Fly   111 IRHFVAAFKREQEHLHVLINNAGVM-----RCPRSLTSDGIELQLGVNHMGHFLLTNLLLDLLKK 170
            ||.......:|...|:||:||||:.     ..|..:.:   |:.:..|..|...:...||.::|.
  Rat    70 IRALRDFLLQEYGGLNVLVNNAGIAFKVVDPTPFHIQA---EVTMKTNFFGTQDVCKELLPIIKP 131

  Fly   171 SSPSRIVNVSSLAHTRG-------------------EINTGDLNSDKSYDEGK------------ 204
            .  .|:|||||....|.                   |...|.:|  |..::.|            
  Rat   132 Q--GRVVNVSSSVSLRALKSCSPELQQKFRSETITEEELVGLMN--KFIEDAKKGVHAKEGWPNS 192

  Fly   205 AYSQSKLANVLFTRELAKRL----EGTNVTANALHPGVVDTEIIRHMGFFNNFFAGLFVKPLFWP 265
            ||..:|:...:.:|..|::|    ....:..||..||.|.|::           ||    |   .
  Rat   193 AYGVTKIGVTVLSRIYARKLNEERREDKILLNACCPGWVRTDM-----------AG----P---K 239

  Fly   266 FVKTPRNGAQTSLYVA-LDPELEKVTGQYFSDCKLK 300
            ..|:|..||:|.:|:| |.|..|...||:..|.|::
  Rat   240 ATKSPEEGAETPVYLALLPPGAEGPHGQFVQDKKVE 275

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 79/296 (27%)
NADB_Rossmann 45..319 CDD:304358 79/296 (27%)
Cbr1NP_062043.1 carb_red_PTCR-like_SDR_c 7..277 CDD:187585 79/296 (27%)
adh_short 7..239 CDD:278532 65/258 (25%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P16152 95..97 0/1 (0%)