DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and Wwox

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_006255728.1 Gene:Wwox / 292041 RGDID:1309927 Length:414 Species:Rattus norvegicus


Alignment Length:336 Identity:128/336 - (38%)
Similarity:185/336 - (55%) Gaps:37/336 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLKSRTAFWLS-----------FTGTTTGLAFFVKDLMQGGQFTKETNETGKVFIVTGANTGIGK 59
            :|..|.||.:.           :.|:||.:     :::||..|      ||||.:|||||:|||.
  Rat    85 YLDPRLAFTVDDNPTKPTTRQRYDGSTTAM-----EILQGRDF------TGKVVLVTGANSGIGF 138

  Fly    60 ETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQESIRHFVAAFKREQEH 124
            ||.:..|..|..|.:||||:.:..||...|:.|.....|.....|||...|::||..|||.:...
  Rat   139 ETAKSFALHGAHVILACRNMSRASEAVSRILEEWHKAKVEAMTLDLAVLRSVQHFAEAFKAKNVP 203

  Fly   125 LHVLINNAGVMRCPRSLTSDGIELQLGVNHMGHFLLTNLLLDLLKKSSPSRIVNVSSLAHTRGEI 189
            ||:|:.|||....|.|||.||:|....|||:|||.|..||.|:|.:|:|:|::.|||.:|...:|
  Rat   204 LHILVCNAGTFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDI 268

  Fly   190 N--TGDLN------SDKSYDEGKAYSQSKLANVLFTRELAKRLEGTNVTANALHPG-VVDTEIIR 245
            |  :|.|:      |...|....||::|||.|:||:.||.:.|....||:|||||| ::.:.|.|
  Rat   269 NDSSGKLDLSRLSLSSSDYWAMLAYNRSKLCNILFSNELHRLLSPRGVTSNALHPGNMMFSAIHR 333

  Fly   246 HMGFFNNFFAGLFVKPLFWPFVKTPRNGAQTSLYVALDPELEKVTGQYFSDCKLKEMAPAATDTQ 310
            :...:...|.      |..||.|:.:.||.|::|.|:.||||.:.|.||::|.....:..|.:.:
  Rat   334 NSWVYKLLFT------LARPFTKSMQQGAATTVYCAVAPELEGLGGMYFNNCCRCLPSEEAQNEE 392

  Fly   311 TAKWLWAVSEK 321
            ||:.||.:||:
  Rat   393 TARALWELSER 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 118/288 (41%)
NADB_Rossmann 45..319 CDD:304358 115/282 (41%)
WwoxXP_006255728.1 WW 18..47 CDD:395320
WW 60..90 CDD:238122 1/4 (25%)
human_WWOX_like_SDR_c-like 124..407 CDD:187669 117/286 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.