DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and Dhrsx

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_006249055.1 Gene:Dhrsx / 288525 RGDID:1305017 Length:331 Species:Rattus norvegicus


Alignment Length:333 Identity:119/333 - (35%)
Similarity:163/333 - (48%) Gaps:21/333 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AFWLSFTGTTTGLAFFVKDL---MQGGQFTKETN-ETGKVFIVTGANTGIGKETVREIAKRGGTV 72
            |.|.:......|:|..:..|   ::||....|.. :..:|.|||||..|:|..|..::|:.|..|
  Rat     4 ALWAALRVYAVGVAVTMVQLLRRLRGGFRPPELPLQADRVAIVTGATRGVGLSTACQLARLGMRV 68

  Fly    73 YMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQESIRHFVAAFKREQEHLHVLINNAGVMRC 137
            .:|..:..:..|....|..|:..:..:....||||..|:|.||..|:.....||:||||||||..
  Rat    69 IVAGNDEHRGHEVVARIQEESGPESAHFLFLDLASLSSVRSFVRNFEATALPLHLLINNAGVMLD 133

  Fly   138 PRSLTSDGIELQLGVNHMGHFLLTNLLLDLLKKSS----PSRIVNVSSLAHTRGEINTGD-LNSD 197
            |...|.||.|..:|||.:||||||:|||..|:.|.    .||::.|.|..|..|:.:... |...
  Rat   134 PSGNTKDGFERHVGVNFLGHFLLTSLLLPALRASGHQGRKSRVITVCSSTHWVGQADVARLLGQS 198

  Fly   198 KSYDEGKAYSQSKLANVLFTRELAKRLE--GTNVTANALHPGVVDTEIIRHMGFFNNF---FAGL 257
            .:.....||:.||||..||:..|.:.|.  |..||||.:.||||||.:..|.|:....   |.| 
  Rat   199 PAPCALAAYAGSKLALALFSLRLQRLLSALGDPVTANIVDPGVVDTALFAHAGWGTRAVQRFLG- 262

  Fly   258 FVKPLFWPFVKTPRNGAQTSLYVALDPELEKVTGQYFSDCKLKEMAPAATDTQTAKWLWAVSEKW 322
                  |...|||..||.||:|.|..|:||.:.|:|..|....|:..||.|.:....|||.|.:.
  Rat   263 ------WLLFKTPDEGAWTSVYAAASPKLEGIGGRYLRDEAEAEVLGAARDLELQGHLWAESCRL 321

  Fly   323 TKPTMIKI 330
            |....:.:
  Rat   322 TGAAWVAV 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 110/289 (38%)
NADB_Rossmann 45..319 CDD:304358 109/283 (39%)
DhrsxXP_006249055.1 PRK06197 36..326 CDD:235737 111/296 (38%)
NADB_Rossmann 41..315 CDD:304358 106/280 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.