DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and Dhrsx

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001028498.2 Gene:Dhrsx / 236082 MGIID:2181510 Length:335 Species:Mus musculus


Alignment Length:286 Identity:118/286 - (41%)
Similarity:153/286 - (53%) Gaps:20/286 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ETGKVFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKC-EEAREEIVLETKNKYVYCRQCDLA 106
            :.|:|.|||||..|||:.|.|::|:.|..|.:| .|.:.| :|....|..|..:...:....|||
Mouse    41 QPGRVAIVTGATAGIGRSTARQLARLGMCVVVA-GNDEHCGQEVVSSIRAEMGSDRAHFLPLDLA 104

  Fly   107 SQESIRHFVAAFKREQEHLHVLINNAGVMRCPRSLTSDGIELQLGVNHMGHFLLTNLLLDLLKKS 171
            |..|:|.|...|:.....||:|:||||||..||:.|.||.|..||||.:||||||.|||..|:.|
Mouse   105 SLASVRGFARDFRALGLPLHLLVNNAGVMLEPRAETEDGFERHLGVNFLGHFLLTLLLLPALRAS 169

  Fly   172 SP----SRIVNVSSLAHTRGEINTGDLNSDKSYDEGKAYSQSKLANVLFTRELAKRLE--GTNVT 230
            ..    ||:|.|.|..|..|.::..||:...:|....||:|||||..||..:|.:.|:  |..||
Mouse   170 GAEGRGSRVVTVGSATHYVGTVDMADLHGRHAYSPYAAYAQSKLALALFALQLQRILDARGDPVT 234

  Fly   231 ANALHPGVVDTEIIRHMGF----FNNFFAGLFVKPLFWPFVKTPRNGAQTSLYVALDPELEKVTG 291
            :|...|||||||:.||.|:    ...|        |.|...|:|..||.|.:|.|..||||.|.|
Mouse   235 SNMADPGVVDTELYRHAGWVLRTVKRF--------LGWLVFKSPEEGAWTLVYAAAAPELEGVGG 291

  Fly   292 QYFSDCKLKEMAPAATDTQTAKWLWA 317
            :|..|....|....|.|.:..:.|||
Mouse   292 RYLRDEAEAEPLGTARDQELQRRLWA 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 118/286 (41%)
NADB_Rossmann 45..319 CDD:304358 118/284 (42%)
DhrsxNP_001028498.2 PRK06197 38..324 CDD:235737 118/286 (41%)
retinol-DH_like_SDR_c_like 43..316 CDD:212492 115/281 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.