DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and DHRSX

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_660160.2 Gene:DHRSX / 207063 HGNCID:18399 Length:330 Species:Homo sapiens


Alignment Length:285 Identity:129/285 - (45%)
Similarity:167/285 - (58%) Gaps:12/285 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KVFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQES 110
            :|.||||...|||..|.:.:|:.|..|.:|..|..|.::...:|..||.|..|....|||||..|
Human    44 RVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTS 108

  Fly   111 IRHFVAAFKREQEHLHVLINNAGVMRCPRSLTSDGIELQLGVNHMGHFLLTNLLLDLLKKS-SP- 173
            ||.||..||.::..|||||||||||..|:..|.||.|...|:|::|||||||||||.||:| || 
Human   109 IRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPG 173

  Fly   174 --SRIVNVSSLAHTRGEINTGDLNSDKSYDEGKAYSQSKLANVLFTRELAKRL--EGTNVTANAL 234
              :|:|.|||..|...|:|..||.|...|....||:|||||.||||..|.:.|  ||::||||.:
Human   174 HSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVV 238

  Fly   235 HPGVVDTEIIRHMGFFNNFFAGLFVKPLF-WPFVKTPRNGAQTSLYVALDPELEKVTGQYFSDCK 298
            .||||:|::.:|:     |:|....|.|. |...|||..||.||:|.|:.||||.|.|.|..:.|
Human   239 DPGVVNTDVYKHV-----FWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGHYLYNEK 298

  Fly   299 LKEMAPAATDTQTAKWLWAVSEKWT 323
            ..:......:.:..:.||:.|.:.|
Human   299 ETKSLHVTYNQKLQQQLWSKSCEMT 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 128/283 (45%)
NADB_Rossmann 45..319 CDD:304358 127/279 (46%)
DHRSXNP_660160.2 PRK06197 39..325 CDD:235737 129/285 (45%)
retinol-DH_like_SDR_c_like 43..316 CDD:212492 125/276 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.