DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and dhs-8

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001022250.1 Gene:dhs-8 / 175108 WormBaseID:WBGene00000972 Length:379 Species:Caenorhabditis elegans


Alignment Length:290 Identity:89/290 - (30%)
Similarity:146/290 - (50%) Gaps:20/290 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KETNETGKVFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQC 103
            |..:.:||.|.:||..:|||..|...:|..|..|.:..|||.:.|..::.|:.:..:..|....|
 Worm    79 KGIDVSGKTFAITGTTSGIGINTAEVLALAGAHVVLMNRNLHESENQKKRILEKKPSAKVDIIFC 143

  Fly   104 DLASQESIRHFVAAFKREQEHLHVLINNAGVMRCPRSLTSDGIELQLGVNHMGHFLLTNLLLDLL 168
            ||:..:::|.....:..:...:|.||.||||.|...:.|.||.|...|||.:.||.|..:||.::
 Worm   144 DLSDLKTVRKAGEDYLAKNWPIHGLILNAGVFRPAAAKTKDGFESHYGVNVVAHFTLLRILLPVV 208

  Fly   169 KKSSPSRIVNVSS-LAHTRGEINTGDLNSDKSYDEG--------KAYSQSKLANVLFTRELAKRL 224
            ::|:|||:|.:|| |:...|...:..::...|..:|        :.|..||:|::|...:|.:..
 Worm   209 RRSAPSRVVFLSSTLSSKHGFKKSMGISEKMSILQGEDSSASTLQMYGASKMADMLIAFKLHRDE 273

  Fly   225 EGTNVTANALHPGV-VDTEIIRHMGFFNNFFAGLFVKPLFWPFVKTPRNGAQTSLYVALDPELEK 288
            ....::..::|||. |.|:|      |.|...|.|:..:..||.|....||.|::|.|..||:||
 Worm   274 YKNGISTYSVHPGSGVRTDI------FRNSLLGKFIGFVTTPFTKNASQGAATTVYCATHPEVEK 332

  Fly   289 VTGQYFSDC----KLKEMAPAATDTQTAKW 314
            ::|:|:..|    |:.:......:.|.|.|
 Worm   333 ISGKYWESCWDNDKIDKKTARDEELQEALW 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 88/286 (31%)
NADB_Rossmann 45..319 CDD:304358 88/284 (31%)
dhs-8NP_001022250.1 PRK06196 68..362 CDD:235736 88/288 (31%)
NADB_Rossmann 85..362 CDD:304358 87/282 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.