DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and DHRS13

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_653284.2 Gene:DHRS13 / 147015 HGNCID:28326 Length:377 Species:Homo sapiens


Alignment Length:286 Identity:125/286 - (43%)
Similarity:177/286 - (61%) Gaps:15/286 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NETGKVFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLA 106
            |..|:..:|||||:||||.|..|:|:||..|.:|||:.::.|.|..::..|:.|..|.....|||
Human    33 NLRGRTAVVTGANSGIGKMTALELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLA 97

  Fly   107 SQESIRHFVAAFKREQEHLHVLINNAGVMRCPRSLTSDGIELQLGVNHMGHFLLTNLLLDLLKKS 171
            |..|:|.|..||...:..|.:||:|||:..|.|  |.:...|.|.|||:|.||||:|||..||..
Human    98 SLASVRAFATAFLSSEPRLDILIHNAGISSCGR--TREAFNLLLRVNHIGPFLLTHLLLPCLKAC 160

  Fly   172 SPSRIVNVSSLAHTRGEINTGDLNSDKSY----DEGKAYSQSKLANVLFTRELAKRLEGTNVTAN 232
            :|||:|.|:|.||.||.::...|  |:..    .|.:||:.:|||||||.||||.:||.|.||..
Human   161 APSRVVVVASAAHCRGRLDFKRL--DRPVVGWRQELRAYADTKLANVLFARELANQLEATGVTCY 223

  Fly   233 ALHPGVVDTEI-IRHM-GFFNNFFAGLFVKPLFWPFVKTPRNGAQTSLYVALDPELEKVTGQYFS 295
            |.|||.|::|: :||: |:...     .::||.|..::.||.||||.||.||...:|.::|:||:
Human   224 AAHPGPVNSELFLRHVPGWLRP-----LLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFA 283

  Fly   296 DCKLKEMAPAATDTQTAKWLWAVSEK 321
            :|.::|:.|||.|.:.|..||..|::
Human   284 NCHVEEVPPAARDDRAAHRLWEASKR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 124/285 (44%)
NADB_Rossmann 45..319 CDD:304358 123/279 (44%)
DHRS13NP_653284.2 retinol-DH_like_SDR_c_like 36..304 CDD:212492 121/276 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..377 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.