DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and LOC100497142

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_002932135.3 Gene:LOC100497142 / 100497142 -ID:- Length:352 Species:Xenopus tropicalis


Alignment Length:286 Identity:110/286 - (38%)
Similarity:166/286 - (58%) Gaps:27/286 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GKVFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQE 109
            ||..::||..:||||||...:||||..|.:...:.:|.:.|..:|..|:.:..|...:.::|:.:
 Frog    66 GKTVLITGGTSGIGKETAIALAKRGARVIITNEDEEKGDTALRQIKRESVSMNVKIMKLNMANLQ 130

  Fly   110 SIRHFVAAFKREQEHLHVLINNAGVMRCPRSL--TSDGIELQLGVNHMGHFLLTNLLLDLLKKSS 172
            |||.|...|.::::.|.:|||||||   |..|  |.:|..:..||||:|.||||:||.:.||..|
 Frog   131 SIREFCKDFVQKEKRLDILINNAGV---PAVLDWTDNGFSMCFGVNHLGTFLLTSLLTERLKSCS 192

  Fly   173 PSRIVNVSSLAHTRGEINTGDLNSDKSYDEGK--AYSQSKLANVLFTRELAKRLEGTNVTANALH 235
            |||::.|:|..|....::..|||    |:...  :|.:||||||.||:|||:::|...||:.|:|
 Frog   193 PSRVITVTSEVHKYQRLDFADLN----YNIVPLFSYCRSKLANVYFTQELARQIERHGVTSCAVH 253

  Fly   236 PGVVDTEIIRHMGFFNNFFAGLF------VKPLFWPFVKTPRNGAQTSLYVALDPELEKVTGQYF 294
            ||.|       :|.:.:.|:.||      :..:|  |:.. ..|||:.::.|:..::.:..|.||
 Frog   254 PGYV-------VGDWTSKFSVLFRIVMYVISSMF--FISC-LEGAQSVIHCAVSDDILQHNGGYF 308

  Fly   295 SDCKLKEMAPAATDTQTAKWLWAVSE 320
            ||||..::.|.|.||..||.||.|||
 Frog   309 SDCKPCKLRPHAQDTGIAKKLWEVSE 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 110/286 (38%)
NADB_Rossmann 45..319 CDD:304358 107/283 (38%)
LOC100497142XP_002932135.3 AraJ 11..>59 CDD:225371
NADB_Rossmann 66..333 CDD:419666 107/283 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.