DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30491 and dhrsx

DIOPT Version :9

Sequence 1:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001243648.1 Gene:dhrsx / 100318301 ZFINID:ZDB-GENE-060620-2 Length:324 Species:Danio rerio


Alignment Length:293 Identity:109/293 - (37%)
Similarity:152/293 - (51%) Gaps:30/293 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ETGKVFIVTGANTGIGKETVREIAKRGGTVYMAC----RNLKKCEEAREEIVLETKNKYVYCRQC 103
            :.|||.||||...|:|.|..|.:......|.:|.    ..|...::.:||: .:.|.:::|   .
Zfish    39 QNGKVAIVTGGTRGMGYEISRHLVSLDMHVIIAGNEEEEGLAAVKKIQEEL-NQGKVEFMY---L 99

  Fly   104 DLASQESIRHFVAAFKREQEHLHVLINNAGVMRCPRSLTSDGIELQLGVNHMGHFLLTNLLLDLL 168
            ||||..|:|.||..:..:...||||:||||||..|...|.||.||..|:|::||||||||||..|
Zfish   100 DLASLTSVRQFVQRYNAKGLPLHVLVNNAGVMLVPERRTEDGFELHFGLNYLGHFLLTNLLLGAL 164

  Fly   169 KKSSP----SRIVNVSSLAHTRGEINTGDLNSDKSYDEGKAYSQSKLANVLFTRELAKRL--EGT 227
            :|:..    ||||.:||..|..|.:...||.....|....||:|||||.:|.:..|.::|  .|.
Zfish   165 RKTGKPGKCSRIVIMSSATHYGGRLTLDDLQGRLCYSSHAAYAQSKLALLLLSYHLQEQLLVRGD 229

  Fly   228 NVTANALHPGVVDTEIIRHMGFFNNFFAGL------FVKPLFWPFVKTPRNGAQTSLYVALDPEL 286
            .||.||:.||:|||.:      ::|..:..      |.|.||    :||..||.|::|.|...||
Zfish   230 PVTVNAVDPGMVDTAL------YDNLCSPAQVAKKPFAKLLF----RTPAEGASTAIYAAAASEL 284

  Fly   287 EKVTGQYFSDCKLKEMAPAATDTQTAKWLWAVS 319
            |.:.|.|..:.:..|.:..:.|.:....||..|
Zfish   285 EGIGGLYLYNGRKTESSALSYDKRLQTKLWKQS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 109/293 (37%)
NADB_Rossmann 45..319 CDD:304358 108/289 (37%)
dhrsxNP_001243648.1 SDR 41..314 CDD:330230 106/286 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.