DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and AT5G08200

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_196437.2 Gene:AT5G08200 / 830716 AraportID:AT5G08200 Length:409 Species:Arabidopsis thaliana


Alignment Length:157 Identity:34/157 - (21%)
Similarity:58/157 - (36%) Gaps:60/157 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PAYDDDEFEDLLPLARRPNGHARLGRYENT----------------------------------- 56
            |.|.:.:|.|       .||...|.|.||.                                   
plant    16 PEYSNGKFRD-------DNGFGFLDRLENCREKSPPRSKILRIPSPTSSPPPSSSSPPFHGSNSP 73

  Fly    57 ----LEVKVQEGDTLQALALRFHSSVADIKRLNKIDRENEIHAHRVIRIPVTVH---NVLLGNGG 114
                :|.::.:.|||..:|:::...|||:|::|.:..:.::.|.:.::||:...   :..|.||.
plant    74 DRGYIEHRISKFDTLAGVAIKYGVEVADVKKMNNLVTDLQMFALKSLQIPLPGRHPPSPCLSNGS 138

  Fly   115 LEALPAVHRSG-----NNSPRHNIERE 136
            |.     |..|     ..||.|: |:|
plant   139 LN-----HGEGCSCHEPESPNHS-EQE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 10/42 (24%)
LysM <60..105 CDD:224306 12/44 (27%)
AT5G08200NP_196437.2 LysM 86..122 CDD:212030 10/35 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20932
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.