DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and Lysmd4

DIOPT Version :10

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_780424.1 Gene:Lysmd4 / 75099 MGIID:1922349 Length:293 Species:Mus musculus


Alignment Length:207 Identity:53/207 - (25%)
Similarity:91/207 - (43%) Gaps:45/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LEVKVQEGDTLQALALRFHSSVADIKRLNKIDRENEIHAHRVIRIPVTVHNVLLGNGGLEALPAV 121
            |:.::.:.|:|..|||::...|||||:.|...||.:::|.:.|:|||..|.:|. ....|.:|. 
Mouse    71 LQRELAQEDSLNKLALQYGCKVADIKKANNFIREQDLYALKSIKIPVRNHGILT-ETHQELMPL- 133

  Fly   122 HRSGNNSPRHNIEREPAPERNPLEDARQMLDERLLVAAVNASGAVDHEKPSTSRAAGQFYEGAQG 186
               |.:|....:.....||           ||       :|.||.......|     .|::|.  
Mouse   134 ---GASSSETRVTLVDLPE-----------DE-------DAGGATTQGNQLT-----DFFKGI-- 170

  Fly   187 APNDEANMEQPYEENAALLNH----MVDRHAPLVRPIPGPSLSAIDWSGSDCDLSWICLLIFILA 247
               || |:|:....:   :.|    .|:....|:.||....::    .|:||.:.|...:..:|.
Mouse   171 ---DE-NIERAVHSD---VFHGDSCCVEAPDQLLLPITQKPVA----DGADCGIQWWNAVFLMLL 224

  Fly   248 LCVVIPLVYVIY 259
            :.:|:|:.|::|
Mouse   225 IGIVLPVFYLVY 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:396179 15/42 (36%)
Lysmd4NP_780424.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..65
LysM 77..115 CDD:197609 15/37 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.