DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and lysmd2

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001037868.1 Gene:lysmd2 / 733450 XenbaseID:XB-GENE-940230 Length:207 Species:Xenopus tropicalis


Alignment Length:87 Identity:26/87 - (29%)
Similarity:44/87 - (50%) Gaps:6/87 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ENTLEVKVQEGDTLQALALRFHSSVADIKRLNKIDRENEIHAHRVIRIPVTVH--NVLLGNGGLE 116
            |..:|.::...||||.:||::..::..|||.||:...:.|...:.:.|||...  ::..|.|.|:
 Frog    58 ERYIEHRLSPSDTLQGIALKYGVTMEQIKRANKLFSTDCIFLRKSLNIPVISKKGSLFNGLGSLD 122

  Fly   117 ALPAVHRSGNNSPRHNIEREPA 138
            :.....:...|||    .:|||
 Frog   123 SPENETQDNCNSP----TKEPA 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 12/42 (29%)
LysM <60..105 CDD:224306 15/44 (34%)
lysmd2NP_001037868.1 LysM 61..105 CDD:212030 13/43 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..207
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 46 1.000 Inparanoid score I5296
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20932
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.