DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and Lysmd2

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_081585.2 Gene:Lysmd2 / 70082 MGIID:1917332 Length:215 Species:Mus musculus


Alignment Length:217 Identity:56/217 - (25%)
Similarity:80/217 - (36%) Gaps:65/217 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ARPAYDDDEFEDLLPLAR---RPNG-----HARLGR--YENTLEVKVQEGDTLQALALRFHSSVA 79
            :|...:.:|.|..|.|||   |..|     .|.||.  .|..:|.:|:.|||||.:||::..::.
Mouse    29 SRSTSEPEEAELSLSLARTKTRSYGSTASVRAPLGAGVIERHVEHRVRAGDTLQGIALKYGVTME 93

  Fly    80 DIKRLNKIDRENEIHAHRVIRIPVTVHNVLLGNG------------------------GLEALPA 120
            .|||.||:...:.|...:.:.||:.....||.||                        ..|.||.
Mouse    94 QIKRANKLFTNDCIFLKKTLSIPILSEKPLLFNGLNSIDSPESETVDSSFCQEEEPVVSEEELPP 158

  Fly   121 VHRSGNNSPRHNIEREPAPERNPLEDARQMLDERLLVAAVNASGAVDHEKPSTSRAAGQFYEGAQ 185
                  .||:....:...||.....|..|.||.::              |.||        :.|:
Mouse   159 ------PSPQDPDPKPAQPEEVSARDFLQRLDLQI--------------KLST--------QAAR 195

  Fly   186 GAPNDEANMEQPYEENAALLNH 207
            ....:..:.|.||   ||.|.|
Mouse   196 KLKEESRDEESPY---AASLYH 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 14/42 (33%)
LysM <60..105 CDD:224306 16/44 (36%)
Lysmd2NP_081585.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 2/10 (20%)
LysM <53..122 CDD:224306 22/68 (32%)
LysM 71..115 CDD:212030 15/43 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..176 7/46 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..215 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.