DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and Lysmd4

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_003748928.1 Gene:Lysmd4 / 681647 RGDID:1592887 Length:310 Species:Rattus norvegicus


Alignment Length:247 Identity:60/247 - (24%)
Similarity:100/247 - (40%) Gaps:65/247 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DDEFEDLLPLARRPNGHARLGRYENT-----------LEVKVQEGDTLQALALRFHSSVADIKRL 84
            |...|:...:..||.|..   |.:|:           |:.::.:.|:|..|||::...|||||:.
  Rat    54 DSSEEESHQVVLRPRGKE---RQKNSSQPPGTGTMVLLQRELAQEDSLNKLALQYGCKVADIKKA 115

  Fly    85 NKIDRENEIHAHRVIRIPVTVHNVLLGNGGLEALPAVHRSGNNSPRHNIEREPAPERNPLEDARQ 149
            |...||.:::|.:.|:|||..|.:|. ....|.:|.    |.:|....:.....||..       
  Rat   116 NNFIREQDLYALKSIKIPVRNHGILT-ETHQELMPL----GASSSETRVTLVELPEDG------- 168

  Fly   150 MLDERLLVAAVNASGAVDHEKPSTSRAAGQFYEGAQGAPNDEANMEQPYEENAALLNHMVDRH-- 212
                       :||||.......|     :|::|.     || |:|:..:.:..        |  
  Rat   169 -----------DASGATAQGNQLT-----EFFKGI-----DE-NIERAVQSDVF--------HSD 203

  Fly   213 -----APLVRPIPGPSLSAIDWSGSDCDLSWICLLIFILALCVVIPLVYVIY 259
                 ||....:|.....|.|  |:||.:.|...:..:|.:.:|:|:.|::|
  Rat   204 GCCVEAPDQPLLPITQKPAAD--GADCGIQWWNAVFLMLLIGIVLPVFYLVY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 15/42 (36%)
LysM <60..105 CDD:224306 18/44 (41%)
Lysmd4XP_003748928.1 LysM 94..132 CDD:197609 15/37 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350976
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2850
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5370
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1180847at2759
OrthoFinder 1 1.000 - - FOG0002722
OrthoInspector 1 1.000 - - otm46013
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.