Sequence 1: | NP_610305.1 | Gene: | CG17985 / 35702 | FlyBaseID: | FBgn0033199 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001003507.1 | Gene: | lysmd2 / 445113 | ZFINID: | ZDB-GENE-040801-250 | Length: | 208 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 50/207 - (24%) |
---|---|---|---|
Similarity: | 82/207 - (39%) | Gaps: | 46/207 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 EFEDLLPLARRPNGHARLGR---------------------------YENT-----------LEV 59
Fly 60 KVQEGDTLQALALRFHSSVADIKRLNKIDRENEIHAHRVIRIPVTVHNVLLGNG-GLEALPAVHR 123
Fly 124 SGNNSP--RHNIER-EPAPERN-PLEDARQMLDERLLVAAVNASGAVDHEKPSTSRAAGQFYEGA 184
Fly 185 QGAPNDEANMEQ 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17985 | NP_610305.1 | LysM | 59..102 | CDD:279777 | 13/42 (31%) |
LysM | <60..105 | CDD:224306 | 16/44 (36%) | ||
lysmd2 | NP_001003507.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..54 | 9/50 (18%) | |
LysM | <28..117 | CDD:224306 | 19/88 (22%) | ||
LysM | 65..109 | CDD:212030 | 14/43 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 122..169 | 11/48 (23%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 187..208 | 7/21 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170592686 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR20932 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |