DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and red

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001247097.1 Gene:red / 41738 FlyBaseID:FBgn0285913 Length:366 Species:Drosophila melanogaster


Alignment Length:203 Identity:43/203 - (21%)
Similarity:83/203 - (40%) Gaps:26/203 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HNQ-EEIGPDDVEDIFARPAYDDDEFEDLLPLARRPNGHARLGRY-----------ENTLEVKVQ 62
            |:| :||.||          .||.||......:.|.:|.. |.||           |..:...|:
  Fly    14 HSQFQEIVPD----------MDDSEFMFNEKQSIRDSGRT-LKRYGSTCCNSLRNNETLIRHIVE 67

  Fly    63 EGDTLQALALRFHSSVADIKRLNKIDRENEIHAHRVIRIPVTVHNVL---LGNGGLEALPAVHRS 124
            :.||||.:||::..:...|:|.|::...:.:...:.:.:||..::..   :....:.|..||..:
  Fly    68 KTDTLQGIALKYGCTTEQIRRANRLFASDSLFLRQFLLVPVEKNSPYYPQVPGDSIAAFDAVLAT 132

  Fly   125 GNNSPRHNIEREPAPERNPLEDARQMLDERLLVAAVNASGAVDHEKPSTSRAAGQFYEGAQGAPN 189
            ...:|..|.:||.....|.|..:.:...:...:::.::|.:........:...|....|::...|
  Fly   133 PPGTPDANGQREAHNNANNLSQSNKSFMKSNDISSSSSSSSSGSSSSCNTSGTGPISGGSRSGGN 197

  Fly   190 DEANMEQP 197
            .:...:||
  Fly   198 QQQQQQQP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 10/42 (24%)
LysM <60..105 CDD:224306 12/44 (27%)
redNP_001247097.1 LysM 62..106 CDD:212030 10/43 (23%)
LysM <64..113 CDD:224306 12/48 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.