DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and lysmd3

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001002104.1 Gene:lysmd3 / 415194 ZFINID:ZDB-GENE-040625-88 Length:305 Species:Danio rerio


Alignment Length:284 Identity:59/284 - (20%)
Similarity:109/284 - (38%) Gaps:91/284 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRRNARQQQHNQEEIGPDDVEDIFARPAYDDDEFEDLLPLARRPNGHARLGRYENTLEVKVQEGD 65
            :|...|::.|.                :...|..:|::.|.|                 :::|||
Zfish    45 LRSRGRERHHR----------------STSRDRKDDIVYLIR-----------------EIKEGD 76

  Fly    66 TLQALALRFHSSVADIKRLNKIDRENEIHAHRVIRIPV-------TVHNVLLGNGGLEALPAVHR 123
            ||.:::|::..:||||||.|.:..|.:..|.|.:||||       ..||.           |.|:
Zfish    77 TLISISLQYFCTVADIKRANNLLTEQDFFALRSLRIPVRKFSSFTETHNT-----------APHK 130

  Fly   124 SGNNSPRHNIEREPAPERNPLEDARQMLDERLLVAAVNASGA-VDHEKPSTSRAAGQFYEGAQGA 187
            |.:.|....|...|                        .||| :|....|:|..:.:.:     .
Zfish   131 SSSPSGTCRITETP------------------------VSGASLDSTSSSSSADSVECF-----L 166

  Fly   188 PNDEANMEQPYEENAALLNHMVDRHAPLVRPIPG-----PSLSAIDWSGSDCDLSWICLLIFILA 247
            ...:.:::|..:.:|...|.:.:..:.|.:|:.|     |::....:.|:|..:.|...:..:|.
Zfish   167 QEKDKDIQQLVKSSAPSRNSLSEVVSSLEQPLLGDAERRPAIKKDPYYGADWGMRWWTAVAIMLV 231

  Fly   248 LCVVIPLVYVIYL-----AEHPHH 266
            :.:|.|:.|::|.     |:..||
Zfish   232 VGIVTPVFYLLYYEVLMKADVSHH 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 17/42 (40%)
LysM <60..105 CDD:224306 20/51 (39%)
lysmd3NP_001002104.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..60 3/30 (10%)
LysM 72..112 CDD:212030 16/39 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..156 12/69 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592683
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2850
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5459
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1180847at2759
OrthoFinder 1 1.000 - - FOG0002722
OrthoInspector 1 1.000 - - otm26560
orthoMCL 1 0.900 - - OOG6_108954
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2979
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.690

Return to query results.
Submit another query.