DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and LYSMD1

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_997716.1 Gene:LYSMD1 / 388695 HGNCID:32070 Length:227 Species:Homo sapiens


Alignment Length:192 Identity:47/192 - (24%)
Similarity:81/192 - (42%) Gaps:46/192 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ENTLEVKVQEGDTLQALALRFHSSVADIKRLNKIDRENEIHAHRVIRIPVTVHNVLLGNG----- 113
            |..||.:::.||||..|||::..::..|||.|::...:.|...:.:.||:......|.||     
Human    37 ERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEE 101

  Fly   114 ---GLEALPAVHRSGNNSPRHNIERE--------------PAPER---NPLEDARQMLDERLLVA 158
               |.|   .||.|.:....|:.||:              |.|.:   .|:.|          ::
Human   102 EKDGEE---KVHPSNSEVWPHSTERKKQETGAGRANGEVLPTPGQETPTPIHD----------LS 153

  Fly   159 AVNASGAVDHEKPSTSRAAGQ-FYEGAQGAPNDEA--NMEQPYEENAALLNHMVDRHAPLVR 217
            |.:....:|.:...:.:||.| ..:|..|.|.::|  ::..|:.:..|:|..:     ||.|
Human   154 ASDFLKKLDSQISLSKKAAAQKLKKGENGVPGEDAGLHLSSPWMQQRAVLGPV-----PLTR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 12/42 (29%)
LysM <60..105 CDD:224306 14/44 (32%)
LYSMD1NP_997716.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
LysM 42..84 CDD:212030 12/41 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..150 11/55 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20932
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.