DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and Lysmd3

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001009698.1 Gene:Lysmd3 / 315923 RGDID:1308805 Length:300 Species:Rattus norvegicus


Alignment Length:252 Identity:63/252 - (25%)
Similarity:102/252 - (40%) Gaps:71/252 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DEFEDLLPLARRPNGHARLGRYENTLEVKVQEGDTLQALALRFHSSVADIKRLNKIDRENEIHAH 96
            |..:|::.|.:                 .:||||||.|:||::..:||||||:|.:..:.:..|.
  Rat    57 DRLDDIVILTK-----------------DIQEGDTLNAVALQYCCTVADIKRVNNLISDQDFFAL 104

  Fly    97 RVIRIPV--------TVHNVLLGNGGLEALPAVHRSGNNSPRHNIEREPAPERNPLEDARQMLDE 153
            |.|:|||        |:|            |...|...:.|       |.|          ...|
  Rat   105 RSIKIPVKRFSSLTETLH------------PLKGRQVLHPP-------PVP----------YFQE 140

  Fly   154 RLLVAAVNASGAVDHEKPSTSRAAGQFYEGAQGAPNDEANMEQPYEENAALLNHMVDR-HAPLVR 217
            :..|.|        ::.||:|.:||.|.:................:||   ||.:|.. .|..||
  Rat   141 QDTVPA--------NDSPSSSESAGSFLKEVDRDIEQIVKCTDTKKEN---LNEVVSALTAQQVR 194

  Fly   218 PIP-GPSLSAID-WSGSDCDLSWICLLIFILALCVVIPLVYVIY---LAEHPHHNHS 269
            ..| ..|:...| :.|:|..:.|...::.:|.:.::.|:.|::|   ||:....:||
  Rat   195 FEPDNKSVHRKDPYYGADWGMGWWTAVVIMLIVGIITPVFYLLYYEILAKVDVSHHS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 19/42 (45%)
LysM <60..105 CDD:224306 22/52 (42%)
Lysmd3NP_001009698.1 LysM 69..109 CDD:197609 19/39 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..157 7/38 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350974
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2850
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5370
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1180847at2759
OrthoFinder 1 1.000 - - FOG0002722
OrthoInspector 1 1.000 - - otm46013
orthoMCL 1 0.900 - - OOG6_108954
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.660

Return to query results.
Submit another query.