DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17985 and CG15471

DIOPT Version :9

Sequence 1:NP_610305.1 Gene:CG17985 / 35702 FlyBaseID:FBgn0033199 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001138156.1 Gene:CG15471 / 31412 FlyBaseID:FBgn0029726 Length:128 Species:Drosophila melanogaster


Alignment Length:112 Identity:29/112 - (25%)
Similarity:50/112 - (44%) Gaps:18/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RYENTLEVKVQEGDTLQALALRFHSSVADIKRLNKIDRENEIHAHRVIRIPVTVHNVLLG---NG 113
            |:..|.|      ||:..|||::.:|:..|.|.|::..::.:.|.|.:.:|:......:|   ..
  Fly    25 RHSITAE------DTMTRLALKYDTSIGRICRANRMHSQDVLQARRHVWVPIPNSQFQMGCQEKS 83

  Fly   114 GLEALP--AVHRSGNNSPRHNIEREPAPERNPLE-DARQMLDERLLV 157
            ..:..|  ::.:...|.|.| ..|:..|..||.. |     |:.|||
  Fly    84 ESDESPEISIRKVTPNLPSH-FYRQSDPNPNPFACD-----DDPLLV 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17985NP_610305.1 LysM 59..102 CDD:279777 11/42 (26%)
LysM <60..105 CDD:224306 12/44 (27%)
CG15471NP_001138156.1 LysM 26..69 CDD:279777 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2850
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.